(data stored in ACNUC1104 zone)

EMBL: CP000509.PE92

CP000509.PE92        Location/Qualifiers
FT   CDS_pept        complement(108849..110423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0097"
FT                   /product="Regulator of polyketide synthase expression-like
FT                   protein"
FT                   /note="KEGG: sco:SCO1052 regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79642"
FT                   /db_xref="InterPro:IPR025736"
FT                   /db_xref="InterPro:IPR041522"
FT                   /db_xref="InterPro:IPR042070"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCV7"
FT                   /protein_id="ABL79642.1"
FT                   /translation="MSAASPVPLVALLAHADWQQVSVLAAPPAPTLTVGGVAMVADIRG
FT                   RAADLEGNLLTVLQPPLRDDWQIDVLIQTAAAGRASALLIGDSSPLSQPSSALAARVGL
FT                   TVLGADDPLAAALTARRLVAEVELHVSDTVLRVTAAAARSGEGVEDVMKAVGSVLHRPL
FT                   ALVAAGGDTLLGSDVVAGEDRETVAGTLTAGAARYRATQRVELSDSALLIAHPVPPTTA
FT                   RDATVWLVTRLPHDLPAESAAASAALSVAAAVIGQRASLRRLAVERDARARASLLGELL
FT                   NAPDDVAPTTRRRALEAGWRLDGWHLGIRIDTGPEVDPVAQRPEVIGALQAEGMDAVVV
FT                   EQGDGWSAWITSEDEPRGADVEARAGQIRSAQRRLAATTPTAVGVGRYHAGPRGVARTL
FT                   GEAGEAARLAAGRVASGRFLHVDRLGLGQTLLAWTRTDTFQPAARSLLAPLEGQPGDLL
FT                   HTLTTYLDEESSVSETAAILGIHRNTVAQRLARIRSLLAVDLADPSERLALHLACRTIW
FT                   IPPSDVG"
     gtgagcgccg cctcgcccgt cccgctcgtc gccctgctgg cccatgccga ctggcagcag        60
     gtgagcgtgc tcgcggcacc gccggcgccg acgctgaccg tcggcggggt cgcgatggtg       120
     gccgacatcc gcggccgggc ggccgacctc gaggggaacc tgctgaccgt gctgcagccg       180
     ccgctgcgcg acgactggca gatcgacgtc ctgatccaga cggccgccgc cggccgtgcc       240
     tcggcgctgc tgatcggcga ctcgtccccg ctctcgcagc cgtcgtcggc cctggccgcg       300
     cgcgtcggcc tgaccgtgct cggggcggac gaccccctgg ccgccgccct gaccgcccgg       360
     aggctggtcg ccgaggtgga gctgcacgtg tccgacaccg tgctgcgggt gacggccgcg       420
     gccgcccggt ccggagaggg cgtcgaggac gtgatgaagg ccgtcggctc ggtcctgcac       480
     cggcccctgg ccctggtggc cgccggcggc gacaccctcc tgggctccga cgtggtcgcg       540
     ggggaggacc gcgagaccgt ggccgggacg ctcaccgcgg gcgcggcccg ctaccgcgcc       600
     acccagcggg tcgagctctc cgactcggcg ctgttgatcg cccacccggt gccgccgacg       660
     acggcgcggg acgccacggt gtggctggtc acccggctcc cccacgacct gcccgccgag       720
     agcgccgccg cgagtgcggc cctctccgtg gccgcggcgg tgatcggcca gcgcgccagc       780
     ctgcgccggc tggccgtcga gcgggacgcc cgggcccgcg cctcactgct gggcgagctg       840
     ctcaacgccc ccgacgacgt ggcacccacc acccggcgtc gcgcgctcga ggccgggtgg       900
     cgcctggacg gctggcacct cggcatccgg atcgacaccg gccccgaggt cgaccccgtg       960
     gcccagcgtc ccgaggtgat cggcgcgctc caggcggagg ggatggacgc cgtcgtcgtg      1020
     gagcagggcg acgggtggtc ggcctggatc acgtccgagg acgagccccg cggtgccgac      1080
     gtcgaggcgc gagcgggcca gatccgcagc gcgcagcgcc ggctcgcggc gaccaccccg      1140
     accgccgtgg gcgtcggtcg ctaccacgcg ggcccgcggg gcgtcgcgcg gaccctgggc      1200
     gaggccgggg aggcggcgcg gctggcggcc ggccgggtcg ccagcgggcg gttcctgcac      1260
     gtggaccgcc tgggcctcgg ccagacgctc ctggcctgga cccggaccga caccttccag      1320
     ccagcggccc ggtccctcct cgcgccgctg gagggacagc cgggcgacct gctgcacacg      1380
     ctcacgacgt acctcgacga ggagtcgtcg gtctcggaga ccgccgcgat cctgggcatc      1440
     caccgcaaca cggtcgcgca acggctggcc cgcatccggt ccctgctcgc cgtcgacctc      1500
     gccgacccct ccgaacggct ggcgctgcac ctcgcctgcc ggacgatctg gatcccgccc      1560
     tcagacgtgg gctag                                                       1575
//

If you have problems or comments...

PBIL Back to PBIL home page