(data stored in ACNUC1104 zone)

EMBL: CP000509.PE93

CP000509.PE93        Location/Qualifiers
FT   CDS_pept        complement(110420..111496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0098"
FT                   /product="protein of unknown function DUF917"
FT                   /note="PFAM: protein of unknown function DUF917; KEGG:
FT                   mes:Meso_1849 protein of unknown function DUF917"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79643"
FT                   /db_xref="InterPro:IPR010318"
FT                   /db_xref="InterPro:IPR027479"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCV8"
FT                   /protein_id="ABL79643.1"
FT                   /translation="MSPPASRTLRAADLEALAVGLCLLGSGGAGDPQPFASVLRSQLGN
FT                   GELVLHAPGGLGGASVVPVGMVGATSVFTEKLPHGGEFGAAVAATGRWTGAAPDAVMGI
FT                   ETAGLNGVTALVAALRMGLPYVDADLAGRGLPRLDQLTWVTAQLPLTPCALAFPGGHTL
FT                   LVDSASATEVERTIRAALAGTGGWAALALPPSPAALLDETACVGTLGRALELGRAHDSL
FT                   RVLADAAEVAEVLGGEVLGEGRVHDVLRHSAGGGLQPESSVTVLDRNGPVLRIETENEF
FT                   LMVLVDGEPRATVPDLICLLDRRTNRPLAVDALRRGDEVFVVVLPAPAWWLAPGRLDRV
FT                   SPAAFAIDSPPLLLGGRP"
     atgagccctc cggcttcccg gaccctgcgc gcggccgacc tcgaggcgct ggcggtcggc        60
     ctgtgcctgc tgggctcggg cggcgccggc gacccgcagc ccttcgcctc cgtgctgcgc       120
     tcgcagctcg gtaacggcga gctggtgctg cacgcacccg gcggtctcgg gggcgcgagc       180
     gtcgtgccgg tggggatggt gggggccacc agcgtgttca ccgagaagct gccccacggc       240
     ggtgagttcg gcgcggccgt cgccgcgacc ggacggtgga ccggcgcggc cccggacgcg       300
     gtgatgggga tcgagacggc cggcctgaac ggcgtcaccg cgctggtggc cgcgctgcgc       360
     atggggctgc cgtacgtcga cgcggacctg gccggacgcg ggctgccccg gctcgaccag       420
     ctgacctggg tgaccgcgca gctgcccctg accccgtgcg ccctcgcgtt cccgggcggc       480
     cacaccttgc tcgtcgacag cgcctccgcc accgaggtgg agaggacgat ccgggccgcg       540
     ctggcgggaa ccggcggctg ggcggccctc gcgctcccgc cgagccccgc cgccctgctg       600
     gacgagacgg cctgcgtggg gaccctgggc cgggcgctcg agctcgggcg cgcgcacgac       660
     tcgctgcgcg tgctggcgga cgccgcggag gtcgcggagg tgctgggggg cgaggtcctc       720
     ggcgagggcc gcgtgcacga cgtgctgcgg cacagcgcgg gcggcgggct gcagcccgag       780
     tcgtcggtga cggtcctcga ccggaacggc cccgtgctgc ggatcgagac ggagaacgag       840
     ttcttgatgg tgctcgtcga cggcgagccc cgggccacgg tccccgacct catctgcctg       900
     ctggaccgcc ggacgaaccg gccgttggcg gtcgacgccc tccggcgcgg cgacgaggtg       960
     ttcgtggtgg tcctgccggc tcccgcgtgg tggctcgcac cgggccgcct cgaccgggtg      1020
     tcgccggccg cgttcgccat cgacagcccg cccctgctcc tgggcgggcg gccgtga         1077
//

If you have problems or comments...

PBIL Back to PBIL home page