(data stored in ACNUC1104 zone)

EMBL: CP000509.PE94

CP000509.PE94        Location/Qualifiers
FT   CDS_pept        111687..112889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0099"
FT                   /product="monosaccharide ABC transporter substrate-binding
FT                   protein, CUT2 family"
FT                   /note="KEGG: rha:RHA1_ro02908 possible ABC sugar
FT                   transporter, substrate binding component; TC 3.A.1.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79644"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCV9"
FT                   /protein_id="ABL79644.1"
FT                   /translation="MKKQIRSAPGVRPRRLAVAALLLPLVLAACSKPGDPASGGGESAK
FT                   GEVTQAATDTVEKFKAVPDFVSPGPAVDVASLAGKSVFVIPLLTTNDYNIQINAAMERV
FT                   AKLADVDFEVYTNEGQPNQWVAGMNQAIAKGVDVIILSGGTDPRALEPQIKEARDRGIK
FT                   VVVSMFWDTSAQFTPDCSGLSVDCVDGVDAIVAAPYQTATRLDADWIAVDSEGAAKILV
FT                   VTSNDAGPSPGQEAAFKDEIATACPSCEATFANVPISKWTTSVQSTVQSELVRNPDIDY
FT                   VVPLYDNMASYAVAAITAAGKQGQVKVVTFNGTPAVLKMIQDGDIVTMDVGESLEGAGF
FT                   AAMDNAFRLMAGMEPSQVADIVPVRIFDTTNIDEAGTPPEVNKGYGDDLEAQYLEVWGL
FT                   G"
     atgaagaagc agatccggtc tgcaccgggc gtgcggccgc ggcggctcgc ggtcgccgcg        60
     ctcctgctgc ccctcgtcct ggcggcctgc tccaagccgg gcgacccggc gtcgggcggc       120
     ggcgagtccg cgaagggcga ggtcacgcag gccgccaccg acacggtcga gaagttcaag       180
     gcggtcccgg acttcgtctc gccgggtccc gcggtggacg tcgcgagcct ggccggcaag       240
     agcgtcttcg tcatcccgct gctgacgacc aacgactaca atatccagat caacgcggcg       300
     atggagcggg tcgcgaagct cgcggacgtc gacttcgagg tctacaccaa cgagggccag       360
     cccaaccagt gggtcgccgg catgaaccag gcgatcgcca agggcgtcga cgtcatcatc       420
     ctcagcggcg gcaccgaccc ccgcgcgctg gagccgcaga tcaaggaggc ccgcgaccgg       480
     ggcatcaagg tcgtggtgag catgttctgg gacacctcgg cccagttcac acccgactgc       540
     tccgggctca gcgtggactg cgtcgacggc gtggacgcca tcgtggccgc gccgtaccag       600
     accgccacgc gcctggacgc cgactggatc gccgtcgact ccgagggtgc cgcgaagatc       660
     ctggtggtga cgtcgaacga cgcgggcccg agcccgggcc aggaggccgc cttcaaggac       720
     gagatcgcga ccgcctgccc ctcctgcgag gcgacgttcg ccaacgtgcc gatcagcaag       780
     tggacgacct ccgtgcagtc gaccgtgcag tccgagctcg tccgcaaccc cgacatcgac       840
     tacgtcgtgc cgctctacga caacatggcc agctacgccg tcgccgccat caccgcggcc       900
     ggcaagcagg gccaggtcaa ggtcgtcacc ttcaacggca cccccgcggt gctcaagatg       960
     atccaggacg gcgacatcgt gaccatggac gtcggggagt ccctcgaggg tgccgggttc      1020
     gccgcgatgg acaacgcctt ccggctgatg gccggcatgg agccctcgca ggtggccgac      1080
     atcgtgccag tgcggatctt cgacaccacc aacatcgacg aggccggcac cccgccggag      1140
     gtcaacaagg gctacgggga cgacctggag gcccagtacc tcgaggtctg gggcctcggg      1200
     tga                                                                    1203
//

If you have problems or comments...

PBIL Back to PBIL home page