(data stored in SCRATCH zone)

EMBL: CP000509.PE95

CP000509.PE95        Location/Qualifiers
FT   CDS_pept        112886..114469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0100"
FT                   /product="monosaccharide ABC transporter ATP-binding
FT                   protein, CUT2 family"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: rha:RHA1_ro09082 ABC sugar transporter, ATP-binding
FT                   component; TC 3.A.1.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79645"
FT                   /db_xref="GOA:A1SCW0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCW0"
FT                   /protein_id="ABL79645.1"
FT                   /translation="MTDPARPVLRMRGVAKTFGLTRVLQDVDLTVRRGEVHGLLGQNGS
FT                   GKSTLIKILAGFHTPDEGSIELDGASVDLPLSAVDRRKHRLRFVHQDLALLPSLTVLEN
FT                   LLADDVATGPGIRPRRRRAELARATAQFDRFGISLRPDTLVRDISRLDRAKLAIARAVS
FT                   HLGDDDGDVAGAGRGLLVLDEPTAFLPHSEVAELIALMRAVAAQGTGVLFVSHDLDEVL
FT                   TVTDRVSVLRDGQLVGSEDTASLARGDLVRLIVGRPVSVLSAGSAPVPASQERPRLQVS
FT                   ALRGGAVQHLDLSVHPGEVVGVTGVIGSGFDEVTQLLFGALRASGGSVAIDDLALEARR
FT                   LSPATAIKAGVAYLPSDRAVQGSAPSLTVGENVALLSLRKGGGPFALTGRRLERHAGKL
FT                   LRDLDVRPPEPTLAYASLSGGNQQKAMMAKWLVTGPKVLLLSEPTQGVDVGAREQIFTL
FT                   IAEAARQGCAVVCSSSDLDQLAQICNRVLLMRRGVISDEVHGEAVTKAGLTEMLFADAV
FT                   VRSRRATSDA"
     gtgaccgatc cggcccgccc ggtcctccgg atgaggggcg tcgccaagac gttcggcctc        60
     acccgggtgc tccaggacgt cgacctcacc gtgcgccgcg gtgaggtcca cggcctgctc       120
     ggccagaacg ggtcgggcaa gtcgacgctg atcaagatcc tcgccgggtt ccacaccccg       180
     gacgaggggt cgatcgagct cgacggtgcg tcggtcgacc tgccgctgtc cgccgtggac       240
     cggcgcaagc atcggctgcg gttcgtccac caggacctgg cgctgctgcc gtcgttgacg       300
     gtgctcgaga acctgctcgc cgacgacgtc gccacggggc cgggcatccg gccccggcgg       360
     cggcgcgccg agctcgcccg cgccaccgcg cagttcgacc ggttcgggat ctcgctgcgc       420
     ccggacacgc tcgtgcggga catctcgcgc ctggaccggg ccaagctggc gatcgcccgc       480
     gccgtcagcc acctcggtga cgatgacggt gacgtggccg gcgcgggtcg ggggctgctg       540
     gtgctcgacg agccgaccgc cttcctgccg cacagcgagg tcgccgagct gatcgcgctg       600
     atgcgggcgg tggccgcgca gggcacgggc gtcctgttcg tgtcgcacga cctcgacgag       660
     gtcctgacgg tgacggaccg cgtcagcgtg ctgcgcgacg gccagctggt cggcagcgag       720
     gacaccgcct cgctggcgcg cggggatctc gtgcggttga tcgtgggccg gccggtctcc       780
     gtgttgagcg ccggctccgc gccggtcccc gcgagccagg agcggccgcg gctccaggtg       840
     agcgcgctgc gcggtggcgc ggtgcagcac ctggacctga gcgtgcaccc gggtgaggtc       900
     gtcggcgtca ccggcgtgat cgggtccggg ttcgacgagg tgacccagct gctcttcgga       960
     gcgctgcggg ccagcggcgg gtcggtcgcg atcgacgacc tcgcgctcga ggcgcgccgg      1020
     ctctcgccgg ccacggcgat caaggccggc gtcgcctacc tccccagtga ccgtgcggtc      1080
     cagggcagtg ccccgagcct gaccgtgggg gagaacgtcg cgctgctctc gctgcgcaag      1140
     ggtggcggtc ccttcgccct gaccggccgg aggctcgagc ggcacgcggg caagctgctc      1200
     cgcgacctcg acgtacgtcc gcccgagccc acgctcgcct acgcctccct cagcggcggc      1260
     aaccagcaga aggcgatgat ggccaagtgg ctggtgaccg gccccaaggt cctgctgctc      1320
     agcgagccca cccagggtgt cgacgtcggg gcgcgcgagc agatcttcac cctcatcgcc      1380
     gaggccgccc ggcagggctg cgcggtcgtg tgctcgagct ccgatctcga ccagctggcc      1440
     cagatctgca accgcgtgct gctcatgcgg cgcggtgtca tctcggacga ggtgcacggt      1500
     gaggccgtca ccaaggccgg cctgaccgag atgctgttcg ccgacgcggt ggtcagatcg      1560
     cgccgcgcca cctccgacgc ctga                                             1584
//

If you have problems or comments...

PBIL Back to PBIL home page