(data stored in ACNUC1104 zone)

EMBL: CP000509.PE97

CP000509.PE97        Location/Qualifiers
FT   CDS_pept        115531..116544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0102"
FT                   /product="dipeptidase, Metallo peptidase, MEROPS family
FT                   M19"
FT                   /note="PFAM: peptidase M19, renal dipeptidase; KEGG:
FT                   dsy:DSY1937 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79647"
FT                   /db_xref="GOA:A1SCW2"
FT                   /db_xref="InterPro:IPR008257"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCW2"
FT                   /protein_id="ABL79647.1"
FT                   /translation="MVVPTLPVADCHNDLLLGVLHQRERGIADPFGDFWLPQLRAGGVA
FT                   LQVLPVFTEEQHVGEGALRRSLQVLEEARRLADVHVADVAICERGDQIRPTIESGRIAL
FT                   VLALEGCEPVGHSLELLDTFHRLGVRIASMTWNRRTMMADGVGEQDAGGRLTTLGLEAV
FT                   AEMERLGMLVDVSHLSETGFWHLASVATRPFVASHSSCRALQPHPRNLTDEQIRAVADS
FT                   GGFVAINGFGPFLSDAPTVDSFLDHVQHAVALVGPERVALGLDFMRDLVDAVDPVLSGA
FT                   LVHPDTPPWVAGLERPADLAALAARLEETLGPRAGRQVAADTVIDTLTRQLAPAPR"
     atggtggtgc cgacgctgcc ggtggcggac tgccacaacg acctgctgct gggtgtcctg        60
     caccagcgcg agcggggcat cgccgacccg ttcggcgact tctggctgcc gcagctgcgg       120
     gccggcggcg tggccctcca ggtgctcccg gtcttcaccg aggagcagca cgtgggcgag       180
     ggcgcgctgc gccggagcct gcaggtgctg gaggaggccc gccgcctggc cgacgtgcac       240
     gtggccgacg tggcgatctg cgagcggggc gaccagatcc ggcccaccat cgagagcggc       300
     cgcatcgcgc tcgtcctcgc actggagggc tgtgagccgg tcggccactc cctcgagctg       360
     ctcgacacct tccaccgcct cggcgtccgg atcgcctcga tgacctggaa ccgccgcacg       420
     atgatggccg acggggtcgg cgagcaggat gccggcggcc gcctgacgac cctcggcctc       480
     gaggcggtcg ccgagatgga gcggctcggc atgctcgtcg acgtcagcca cctctcggag       540
     accggcttct ggcacctggc ctcggtcgcg accaggccct tcgtcgcgag ccactcctcc       600
     tgccgggccc tgcagccgca cccgcgcaac ctcaccgacg agcagatccg ggcggtggcc       660
     gacagcgggg gcttcgtcgc catcaacggg ttcggcccgt tcctgtccga cgcccccacg       720
     gtggactcgt tcctcgacca cgtccagcac gcggtcgcgc tggtgggtcc cgagcgcgtc       780
     gcgctcggcc tggacttcat gcgcgacctc gtggacgcgg tcgaccccgt gctctccggt       840
     gcgctcgtcc accccgacac cccgccctgg gtcgccggcc tcgagcggcc cgccgacctc       900
     gccgcgctcg cggcgcggct ggaggagacg ctggggccgc gagccggccg ccaggtggct       960
     gccgacaccg tcatcgacac cctgacgcgg cagctggctc cggcgccgcg ctga            1014
//

If you have problems or comments...

PBIL Back to PBIL home page