(data stored in ACNUC29543 zone)

EMBL: CP000521.PE100

CP000521.PE100       Location/Qualifiers
FT   CDS_pept        117345..118784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0098"
FT                   /product="D-serine/D-alanine/glycine transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10587"
FT                   /protein_id="ABO10587.2"
FT                   /translation="MTTARHSDMENSPDHLQRKLSNRHLQLIAIGGAIGTGLFMGSGKT
FT                   ISLAGPSILFIYMIIGGMFFFLMRAMGELLLANLHYKSFVDMAHDLIGPWAGYYLGWTY
FT                   WLGWVLVGIADLSAVINYLSFWLPDGASFSPIQQAMISAGCVLFVMGLNLLTVRLFGEI
FT                   EFWFALIKILAIIGLIGVGGYMIFSHFQAPQGAVASISNVWSHGGLFPKGTEGFLAGFQ
FT                   IAVFAFVGVELVGTTAAETKDPQKNLPKAINAIPVRIILFYVLALFIVMSVTPWDHIRA
FT                   DKSPFVELFLNAGIPVSAIIMNLVVLSSVMSSMNSGVFSTSRMLFGLSKDGQAPGAFGR
FT                   LSKRAVPSNGLIFSCTFIMGGAVLQYFVPNTMEAFTLASSLCVILFISVWSLIMVCYLR
FT                   YRKLRPELHEKSTFKMPGGIWMSYVVLAFMLFTLVILALEPDTLKALYVSPVWLIILGV
FT                   TYHVLYKPRMKRLGRELVNDH"
     atgacaacgg ctcgtcattc agatatggaa aattctcctg atcatctgca acgaaaactg        60
     tctaaccgtc atttacaact gattgcaatt ggcggtgcaa ttggaaccgg cctatttatg       120
     ggttcgggca aaaccatctc cctcgcaggt ccttcaattc tctttattta tatgattatt       180
     ggaggcatgt tctttttctt aatgcgtgca atgggtgaac tactccttgc aaatctgcat       240
     tacaaatctt ttgttgatat ggctcatgac ctgattggtc cttgggccgg ttattatttg       300
     ggttggacct attggttagg ttgggtgctg gtcggtattg cggacctttc agcagtcatt       360
     aactatttga gcttctggct acccgatggt gcaagcttct caccaataca gcaggccatg       420
     attagtgcag gctgtgtgtt gtttgtgatg ggacttaacc tccttacagt acgtctattt       480
     ggtgaaattg aattctggtt tgcccttatt aagattctgg caattattgg cctgatcggt       540
     gtgggtggct acatgatttt cagccatttc caagctccgc aaggcgccgt tgccagcatt       600
     agtaatgtct ggtcacatgg cggtttattc ccgaaaggta cagaaggctt cttggcagga       660
     ttccagatag ccgtttttgc gtttgtcggg gttgagttgg ttggtacgac agctgctgaa       720
     acgaaagacc cgcagaagaa cttaccgaaa gcaattaacg cgattccggt acgtattatt       780
     ttgttctatg tattggcgtt atttattgtg atgtcggtaa caccgtggga tcacattcgt       840
     gcagataaaa gcccgtttgt tgagttattc ttaaatgcgg gtattccggt ttctgcgatc       900
     attatgaact tggtggtgct atcttcggtc atgtcttcaa tgaacagcgg tgtgttttca       960
     accagtcgta tgctgttcgg tttatcaaaa gacggtcagg caccgggagc atttggacgt      1020
     ttatcaaaac gcgcagtccc atcaaatggt ttgattttct cttgtacttt cattatgggc      1080
     ggggcagtgc ttcagtactt tgttccaaac acaatggagg catttacatt agcaagttca      1140
     ctctgtgtga ttctcttcat tagtgtctgg agtctcatta tggtgtgcta tttacgctat      1200
     cgtaaattac gtcctgaatt acatgaaaaa tctacattca aaatgccggg cggcatttgg      1260
     atgagttatg ttgttttggc attcatgctt ttcactttgg tgatcttggc attagagcct      1320
     gataccttaa aagcgctata tgtcagtcca gtatggttga tcattttagg tgtgacttat      1380
     catgtgctgt ataaaccgcg catgaaaaga ctaggacgtg aactcgtcaa cgaccattaa      1440
//

If you have problems or comments...

PBIL Back to PBIL home page