(data stored in ACNUC29543 zone)

EMBL: CP000521.PE110

CP000521.PE110       Location/Qualifiers
FT   CDS_pept        complement(131006..131371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10597"
FT                   /protein_id="ABO10597.1"
FT                   /translation="MNENQLMSYPLQHIISIVESRHTEASQIFYYGFTEWATSQTPALS
FT                   TGWDWELIENNGITTVKRVGLPRSNIMIVDVSGMDIGFDINETLLEKKIDTLFWEPFIY
FT                   AQINTSLTKSSLSQTFS"
     atgaacgaaa accaactcat gagttatcct ctccaacaca tcatctctat cgttgaatct        60
     agacatactg aagcgtctca aattttctat tatggtttta ctgaatgggc aacttcacaa       120
     actccagctt taagtaccgg atgggattgg gaactcattg agaataatgg catcactacc       180
     gtaaaacgag tggggttacc tcgaagcaat atcatgattg ttgatgtatc tggtatggat       240
     atcggatttg atattaatga aacattactc gagaaaaaaa tagatacttt gttctgggaa       300
     ccgtttattt atgcccaaat caatacgtca ttaaccaagt cttcattaag tcaaaccttc       360
     tcttag                                                                  366
//

If you have problems or comments...

PBIL Back to PBIL home page