(data stored in ACNUC29543 zone)

EMBL: CP000521.PE115

CP000521.PE115       Location/Qualifiers
FT   CDS_pept        137484..141443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0115"
FT                   /product="Amino acid adenylation"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10602"
FT                   /protein_id="ABO10602.2"
FT                   /translation="MNNLARLEPEVLSRHAISAEQLGIWYIQRFEPTCSAYNMVVAFDV
FT                   KVNQSLGNKPIEILEAVMHDYPLLRVSMPANDQGIEQLIWDRVYPNIIFSDARHIEASD
FT                   LTQLVEQDTKQPFDLTQPPLWRIHCYERGQNHYVIAFVIHHALMDFWSIGLLLRDVSKR
FT                   FGLVAESDAVNGIEFAQYADKQQSNVIDDTDESLLFWKNALKHAPHVHSIPLDYPRPAV
FT                   QQHKGSSLAFRVPESVSSGLINLAKDYEITLFGLVLSGFYILLHKLSNENNLVIATPVA
FT                   GRLERSLRNALGQFVNTIAIHIDIDADQTLRQFTQQVQEQLRQSLKHQKVAFSRVVEAV
FT                   APKRDGSINPLAQIGMFWERLGGMDEFKELLLPIQTPATLVGQDLTLGSFPVRQQEGQL
FT                   DITLEMGGEYQGELVGVLKYNTDLFSAQSAENMVQLLQAVLAEMVAHPERKIVELDIAP
FT                   DYKDGIQFEALRGKVTDYAQHDLLGMILKQIVERGENHALTSNDHTVSYRELGQHIAGI
FT                   AEYLRAHGITQGDRVGLMLDRTALLPAAILGIWAAGAAYVPLDPNFPTERLQNIIEDAE
FT                   PKVILTQTELMDGLNVSVPRLDINQAGVVALEQVRETLAFGDIAYVMYTSGSTGKPKGV
FT                   RIGHPSIINFLLSMNDRLQVTTETQLLAITTYAFDISILELLIPLMYGGVVHVCPREVS
FT                   QDGNQLVDYLNAKSINILQATPASWKMLLDSEWSGNAGLTALCGGEALDTILAEKLLGK
FT                   VGCLWNVYGPTETTVWSSAARITDAKCIDLGEPLANTQLYVLDEQQRLVPPGVMGELWI
FT                   GGDGLAVDYWHRPELTDAQFRTLPSLPNAGRLYRTGDKVCLRTDGRLTHHGRLDFQVKI
FT                   RGFRIELGEIENVLKQIDGITDAVVLVKTTAGNDQKLVAYVTGQELDIAGLKKTMQIHL
FT                   PAYMVPSAFIRLDEFPMTANNKLDRKAFPEPIFEQSNDYVAPRDPIEIELCTTFEQILS
FT                   VKRVGIHDDFFELGGHSLLAVKLVNHLKKAFGTELSVALLAQYSTVERLGEIIRENKEI
FT                   KPSIVIELRRGTSEQPLWLFHPIGGSTFCYMELSRHLNPNRTLRAIQSPGLIEADAAEV
FT                   AIEEMATLYIAEMRKMQPQGPYFLGGWCFGGAIAYEISRQLRQMGQQVTGIVMIDTRAP
FT                   IPENVPEDADDAMLLSWFARDLAAPYGKKLTIPAQYLRELSPDQMFDHVLKEAKAINVL
FT                   PLDADPSDFRLYFDTYLANGIALQTYFPEPEDFPILLVKAKDEQEDFGESLGWDQLVKD
FT                   TLTQVDLPGDHSSIMYAENVVAVAQTIDQMYPIPA"
     atgaacaacc ttgcacgact agaaccagaa gttctgtcgc gtcatgcgat ttctgcagag        60
     cagcttggca tttggtatat ccagcgtttt gagccaactt gcagtgctta caatatggtg       120
     gtggcctttg atgtgaaggt caaccagtca ttgggtaaca agccaataga gatactagaa       180
     gcggtaatgc atgattatcc gctactgcgc gtaagcatgc cagccaatga tcagggaatt       240
     gagcaactga tctgggatcg cgtgtacccg aatatcatct tttctgatgc tcgtcatatt       300
     gaagcttctg atttgacgca attggttgaa caggacacca agcagccatt tgacctgact       360
     cagccaccgt tatggcgtat tcattgttat gaacgcggtc aaaatcatta tgtgatcgca       420
     tttgtgattc atcatgcgct catggatttt tggtcaattg gtctattgct gcgagacgtt       480
     agcaaacgtt ttggactcgt tgcagagtcg gatgcagtga acggaattga gtttgcacag       540
     tatgccgata agcagcagag caatgtaatc gatgatactg atgagagttt acttttctgg       600
     aaaaatgcgc tgaagcatgc accacatgtg catagcattc cgcttgatta tcctcgtcca       660
     gctgtacagc aacataaagg cagttcactg gctttccgtg tacctgagtc agtgtcatct       720
     ggtcttataa acttggcgaa agattatgag atcacattgt tcgggcttgt gttatctggc       780
     ttttatattt tgctgcacaa actatctaat gaaaataatc tagtgattgc tacgcccgta       840
     gcaggtcgac ttgaacgttc tttacgtaat gcattgggtc agtttgtcaa cacgattgct       900
     attcacatag acatcgatgc tgatcagact ttacgtcaat ttacgcaaca ggttcaggaa       960
     caattaagac aaagcctcaa acatcaaaaa gttgcctttt ctagagtagt tgaagctgtc      1020
     gcaccaaaac gtgatggaag tattaatcca ttggctcaga taggaatgtt ctgggaacgt      1080
     ctgggtggta tggatgagtt taaagaacta ctcctaccaa tccagactcc ggccactttg      1140
     gttggacaag atttgacgtt aggaagtttt ccggtccgcc agcaagaagg acagttggat      1200
     attacgctgg aaatgggcgg tgaatatcaa ggtgaactcg ttggcgtatt aaaatacaac      1260
     actgatctat tttctgcgca gtctgccgag aatatggtgc aattgttgca agctgtactc      1320
     gcagagatgg tggcccatcc tgaacgtaag attgttgagc tagatatcgc tcctgattat      1380
     aaagatggca ttcagttcga ggctctccgt ggaaaggtga ctgattatgc tcagcatgat      1440
     ctacttggaa tgattctaaa gcagattgtt gagcgtggtg aaaatcatgc tctgacctcg      1500
     aacgatcata cggttagcta tcgtgagtta ggtcaacata ttgcgggtat tgctgaatat      1560
     ttgcgtgcac acggtattac tcaaggtgat cgtgtaggtc taatgttaga ccgcacagcg      1620
     ttattgccag cagcaatcct tggaatctgg gcggcaggtg cagcttatgt accgctagat      1680
     cctaatttcc caactgaacg tctacagaac attattgaag acgctgaacc taaagtcatc      1740
     ttgactcaaa ccgagttaat ggatggtctt aacgtttctg tgcctcgctt agatatcaat      1800
     caagctggtg ttgtggcact tgaacaagtg cgcgagacgc ttgcctttgg tgacatagct      1860
     tatgtgatgt acacatcagg ctcgacaggt aagcctaaag gtgtccgtat tgggcatcct      1920
     tcaattatca atttcttgct atctatgaat gatagattgc aagtaacgac tgaaactcag      1980
     ttgttagcaa tcaccacgta tgcatttgat atttcaattc ttgaattact cattccgctg      2040
     atgtacggcg gtgtggtgca tgtttgccca cgtgaggtat cacaagatgg caatcaattg      2100
     gtggattatc taaatgccaa gtctatcaat attctgcagg caacaccggc ttcttggaaa      2160
     atgctcttag acagcgagtg gagcggcaat gcgggattga cagcactctg tggaggcgaa      2220
     gcgttagata ctattctggc agaaaaactg ctgggtaaag tcggttgctt atggaatgtc      2280
     tatggtccga ccgaaactac agtgtggtct agtgcggctc gtatcactga tgcaaagtgt      2340
     attgatttag gtgaaccact ggcgaacacc cagctttatg tccttgatga gcagcagcgt      2400
     ttagttccac caggtgttat gggtgagctt tggattggtg gtgatggtct ggcagttgat      2460
     tactggcata gacctgaact gacagatgca caatttagaa cattgccatc tctaccaaat      2520
     gctggtcgac tctaccgtac aggggataaa gtctgcctgc gtacagatgg acgcttgact      2580
     catcacggac gtttggactt tcaggtcaag atccgcggat tccgtatcga attaggtgaa      2640
     atcgagaatg ttctcaaaca gatcgacggt atcacagatg cagtagtgct ggttaagacc      2700
     acagctggca atgaccagaa attggtggcg tatgtaactg gacaagagct tgatattgcc      2760
     ggtttgaaaa agactatgca aatccatctt ccagcttata tggtgccaag tgcgtttatc      2820
     cgattggatg agtttccaat gacggccaac aataagttgg atcgtaaggc atttcctgag      2880
     ccgatctttg agcagagcaa tgattatgtt gcaccacgtg atccgatcga aatcgagctg      2940
     tgtactacct ttgaacagat cttgtcggtc aagcgagttg gtatacatga tgatttcttt      3000
     gaattaggtg ggcattcact attagctgtg aagcttgtca atcatctcaa aaaggctttc      3060
     ggtaccgaac tgtcagttgc tttgttggca cagtactcca ctgtggaacg tctgggtgag      3120
     atcattcgtg aaaataaaga aattaaacca tccatcgtaa ttgagctgcg ccgtggaacc      3180
     tctgagcaac cgttgtggct gttccatcca attggtggca gtaccttctg ttatatggaa      3240
     ctttcgcgtc atcttaatcc gaaccgtacc ctacgtgcta ttcagtctcc tggactgatt      3300
     gaggcagatg ctgcggaagt ggcgattgaa gaaatggcga cgctctatat tgctgaaatg      3360
     cgaaagatgc aacctcaagg gccttatttc ctcggtggtt ggtgtttcgg tggggcgatt      3420
     gcctacgaga ttagccgtca gttgcgtcaa atgggacaac aggtcacagg tattgtcatg      3480
     atcgataccc gtgctccaat tccagaaaat gtacctgaag atgccgacga tgccatgctt      3540
     ttgtcttggt tcgcccgtga tttggctgca ccttatggca aaaagttgac gatcccagcg      3600
     caatatttgc gtgagttgag tccagatcaa atgtttgatc atgtacttaa agaagctaaa      3660
     gccattaatg ttctgcctct cgatgcagac ccatcagatt tccgacttta ctttgatact      3720
     tatttggcga atggcatcgc actccagacc tatttcccag aacctgaaga ttttccaatc      3780
     cttttggtta aggccaaaga tgagcaggaa gactttggag aaagtctagg ttgggatcaa      3840
     ctagtcaaag acacgttgac acaagttgat ttgcctggtg accactcatc aattatgtac      3900
     gctgagaatg tcgtggctgt agcccagacc attgatcaga tgtacccaat tcctgcataa      3960
//

If you have problems or comments...

PBIL Back to PBIL home page