(data stored in ACNUC29543 zone)

EMBL: CP000521.PE119

CP000521.PE119       Location/Qualifiers
FT   CDS_pept        148301..149065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0119"
FT                   /product="Phosphopantethiene-protein transferase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10606"
FT                   /protein_id="ABO10606.2"
FT                   /translation="MSDIAQVQVYVCPVSRVPDNHLILSHYLSFLNAAEKLRYDQYHSH
FT                   AARLFLISRVLMKSVLSDKLGILPHEVIIQLQPNGKPFVRGNKAIYFNLSHSADLIVFA
FT                   VTEKREIGVDVERMNHEFEWRRVDSVLAPSEIEWIQQNEWTNPTSVYQRFFQIWTLKES
FT                   YIKCTGEGMSRHLKKLNFHVSPEHIQFCDLTNNDVQRTEQYHFKSYIYNYSFIFSLCLQ
FT                   QSHCLESFNIDCFQLLPYISTHRITLEPCEHN"
     atgtctgata tagcccaagt acaggtttat gtttgcccag tttcacgggt accagataac        60
     catctcatat tgagtcatta tctcagcttt ctcaatgcgg cagaaaagct gagatatgat       120
     caatatcatt ctcatgctgc acgacttttc ttaatttctc gtgtgttaat gaagtctgtt       180
     ttatcagata agttgggtat cttgccccat gaggtcatca ttcaattaca acctaacggc       240
     aaaccttttg tacgaggcaa taaggctatt tattttaatc ttagtcactc cgcggacctt       300
     attgtctttg ctgtgacaga aaaaagagaa ataggagtcg atgttgaaag aatgaaccat       360
     gagttcgaat ggaggcgtgt cgatagcgtg ttagcgccaa gtgaaattga atggattcag       420
     caaaatgaat ggactaatcc aactagtgta taccaacgtt tttttcaaat atggacctta       480
     aaagaatcct atattaaatg tactggtgaa ggaatgagcc gtcatttaaa gaagctcaac       540
     tttcatgtat ctcctgaaca tatacaattt tgcgatttaa ccaataatga tgttcaaaga       600
     accgagcagt atcattttaa aagttatatc tataattata gttttatctt ctccctatgt       660
     ttacagcaga gtcattgcct agaaagtttt aatatagatt gttttcaatt attaccttat       720
     atatctacac atcgaataac tctagaacct tgcgaacata actaa                       765
//

If you have problems or comments...

PBIL Back to PBIL home page