(data stored in ACNUC29543 zone)

EMBL: CP000521.PE121

CP000521.PE121       Location/Qualifiers
FT   CDS_pept        149907..150299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0123"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10608"
FT                   /protein_id="ABO10608.2"
FT                   /translation="MDAHLLTKLIHMTAVAAALMVFVLRASTLFIGVQGEQPNPAGRKV
FT                   LVALQHLSFTVVFITGAILLVMKNFQVQPWFYAKIILFLVLLSSLMKAFKKDDTILLAQ
FT                   RRAGLVISAIAFVAIIILVIVKPVFA"
     atggatgcac atttactcac taaacttatc catatgactg cggtagcagc cgcacttatg        60
     gtttttgtat tacgcgcttc tacactattt attggtgtac aaggtgaaca acctaaccca       120
     gcagggcgta aagttttagt tgctttacag catttgtcat ttaccgtggt tttcattacc       180
     ggagcaattt tactggtgat gaagaacttt caggtacagc catggttcta cgctaaaatt       240
     atcttatttt tagtgctctt atcatcttta atgaaagcct ttaaaaagga tgacactatt       300
     ttactagctc agcgtcgtgc gggtttggtc attagtgcaa tcgcatttgt tgccattatt       360
     attttggtga tagtgaaacc tgtttttgct taa                                    393
//

If you have problems or comments...

PBIL Back to PBIL home page