(data stored in ACNUC29543 zone)

EMBL: CP000521.PE13

CP000521.PE13        Location/Qualifiers
FT   CDS_pept        complement(14971..16098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0013"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10510"
FT                   /protein_id="ABO10510.2"
FT                   /translation="MSAIYIGVMTGTSMDGVDIVAASFEPLQLHATLTVPFEPELRDEL
FT                   MALTLPDDNEIDRMGKADVALAKMIGHGINSLIEKHQLDRNQIKAIGSHGQTIRHRPEH
FT                   GFTLQIGDPNIITEITQIPVVSDFRRRDMAAGGQGAPLVPAFHQALFQHPSIHRVILNL
FT                   GGIANVSMLPANNPDGVFGFDTGPANILMDAWCHRHTGHPYDENGDWAAYGHPIRSLLD
FT                   RLYAHEYFSKEPPKSTGREDFNIDWLDDQLIDWRNDLTYDELEDTPENIQATLLKLTVR
FT                   AIQKAIYRSNMETGEVYVCGGGAYNSYLLEQLRWRLRKHNWSVQTTDVLGLSPTWVEAT
FT                   AFAWLAMRFVDGLSGNLPAVTGASDFRILGTITAV"
     atgagcgcaa tctatatcgg cgtaatgact ggcactagta tggatggtgt ggatattgtt        60
     gcggcttcat ttgagccact acagcttcat gccacactta cagttccatt cgaacccgag       120
     ttacgtgatg agcttatggc attaacttta cccgatgaca atgaaattga ccgcatgggt       180
     aaagctgatg ttgctctagc caaaatgatt ggtcacggga ttaattctct cattgaaaag       240
     caccaattag atcgtaatca aattaaagcg attgggtcgc atggacaaac cattcgtcat       300
     cgtccagagc atggttttac gctacaaatt ggcgatccaa acattattac tgagatcact       360
     caaatcccgg tcgtttcaga ttttcgtcgt agagatatgg cagcaggtgg tcaaggcgct       420
     ccattagtgc ctgcatttca tcaggcatta ttccaacatc caagcattca tcgggtgatt       480
     ttgaatttgg gtggcattgc caatgtgagc atgttgcctg ccaataatcc tgacggcgta       540
     tttgggtttg atacgggacc tgccaatatt ttgatggatg catggtgtca tcgccataca       600
     ggtcatccat atgatgaaaa tggcgattgg gcagcttatg gtcatcctat tcgctcttta       660
     ctcgaccgtc tttatgctca tgagtatttt tctaaagagc cacctaaaag tacgggacgt       720
     gaagatttca atattgactg gttagatgat cagttaatcg attggcgtaa tgatttaact       780
     tatgatgagt tagaagatac acctgaaaat attcaagcta ccttattaaa acttactgta       840
     cgtgccattc aaaaagcgat ctatcgttct aatatggaaa caggtgaagt ttatgtatgt       900
     ggaggtggag cttataactc ctatttgtta gaacaattac gttggcgctt acgtaagcac       960
     aattggtcag ttcaaaccac tgatgtttta ggactctccc ctacttgggt tgaggctaca      1020
     gcatttgcat ggttagcaat gcgttttgtg gatggtttaa gtggtaattt acctgcggta      1080
     acaggagcct cagattttag aatcttaggc acgatcacgg cggtataa                   1128
//

If you have problems or comments...

PBIL Back to PBIL home page