(data stored in ACNUC29543 zone)

EMBL: CP000521.PE132

CP000521.PE132       Location/Qualifiers
FT   CDS_pept        159056..160003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0134"
FT                   /product="pirin-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10619"
FT                   /protein_id="ABO10619.2"
FT                   /translation="MSNNNDYDISDSKDCEKFANQFIQEFPIRSAEIGQGTVIKRALPS
FT                   RQKRMIGAWCFLDHAGPVTFPAGNGLDVGPHPHIGLQTFTWMIEGTMMHTDSLGSKQLI
FT                   RPKQVNLMTAGHGISHTEVAPDTETQMHAAQLWIALPDHKRNMDPKFEHYPDLPVVEKD
FT                   GLEFTVLVGEYLETTSPVVVHTPLVGVDLIATQDTKTRIPLNPEFEYGFMALDGVAHVN
FT                   GHELTADNMVVLDTGLNEIEIEVKKGNRVLLIGGEPFETPILLWWNFVARTMDDLKEAR
FT                   EQWVNHDVRFGEIPDYVGARLEAPVLPDQMRASK"
     atgagcaata ataacgatta cgatatttcg gattcaaagg attgcgaaaa atttgccaat        60
     caatttattc aggaatttcc aattcgctct gccgaaattg gacaggggac ggtgattaag       120
     cgggctttac ctagtcgaca aaaaagaatg attggggcat ggtgcttttt agatcatgca       180
     ggaccagtaa catttcctgc cggcaatggt ttagatgtag gacctcatcc acatattggt       240
     ttgcaaacct tcacttggat gattgaaggg accatgatgc ataccgatag tttagggtca       300
     aagcaattaa ttcgccctaa acaggtaaac ttgatgacag caggacatgg tatttctcat       360
     accgaggttg cacctgatac tgaaactcaa atgcatgcgg cacagctctg gattgcattg       420
     ccggaccata agcgcaacat ggatccgaaa tttgaacatt atcccgatct tcctgttgtt       480
     gaaaaagacg gcctggaatt tactgtactg gtgggtgaat atttagagac gacttctcca       540
     gttgtggttc atacaccgtt agtaggggtt gatctcattg ctacccaaga tactaagaca       600
     cgtattccac taaatcctga atttgaatat ggttttatgg cattagatgg cgtagctcat       660
     gtgaatggcc atgaacttac tgctgacaat atggttgtat tggatacagg tttgaacgaa       720
     attgagattg aagtaaagaa agggaaccgt gtgctattaa tcggtggtga accttttgaa       780
     actccgatct tattatggtg gaatttcgtt gcacgtacga tggacgattt aaaagaagca       840
     cgtgagcaat gggttaatca tgacgtgcgt tttggtgaaa ttccagatta tgtgggtgcc       900
     cgcttagaag caccagttct tccagatcaa atgagagcat caaaatga                    948
//

If you have problems or comments...

PBIL Back to PBIL home page