(data stored in ACNUC29543 zone)

EMBL: CP000521.PE133

CP000521.PE133       Location/Qualifiers
FT   CDS_pept        160000..160407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0135"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10620"
FT                   /protein_id="ABO10620.2"
FT                   /translation="MTAVIASSKAKPLAEQWKGEITSGRHQYFCDEPEKLEGHDQGPAP
FT                   YDLLTGSLAACTLITLRMYAKHKGYDFGEYSVEIDFHTNREHEEHIERRIVFKELPNEE
FT                   LQQKILTICSKTPVTKTLLRSLDIHTVLVTA"
     atgacagcag taattgcgag cagtaaagca aagcctcttg cagaacaatg gaaaggtgaa        60
     attaccagcg gccgtcatca atacttttgt gatgagcctg aaaagctaga agggcatgac       120
     caagggcctg caccttatga tttgcttacc ggaagtctgg cagcatgtac acttattact       180
     ttaagaatgt atgcaaaaca taagggttat gattttggtg agtactcggt tgaaattgat       240
     tttcatacca accgagagca tgaagaacat atcgagcgtc gtattgtttt taaagaactt       300
     ccaaacgaag aacttcagca aaaaatctta acgatatgca gtaaaactcc agtcactaaa       360
     actttgttac gtagtttaga cattcatact gtgcttgtta cagcataa                    408
//

If you have problems or comments...

PBIL Back to PBIL home page