(data stored in ACNUC29543 zone)

EMBL: CP000521.PE142

CP000521.PE142       Location/Qualifiers
FT   CDS_pept        169979..170782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0146"
FT                   /product="high affinity Zn transport protein"
FT                   /note="ABC superfamily peri_bind"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10629"
FT                   /protein_id="ABO10629.2"
FT                   /translation="MSTLGWSQGLVVSTHPIYLIAKEITKGVEEPQLLLQGQSGHDVQL
FT                   TPAHRKAINDATLVIWLGKAHEAPLNKLLSNNKKAIALLDSGILSILPQRNTRGAALPN
FT                   TVDTHVWLEPNNAVRIGFFIAALRSQQHPENKAKYWNNANTFARNMLQAAQAYDSSSNG
FT                   KPYWSYHDAYQYLERSLNLKFAGALTDDPHVAPTAAQIKYLNDSRPKAQMCLLAESFTT
FT                   KGQYQKLGSITFQPVDESMNNEDNFVTAWKKLAIKTDKCVLNTQK"
     atgagtacgt taggttggag tcagggtttg gttgtctcta cgcacccaat ctatttgatt        60
     gcaaaagaaa ttaccaaagg agttgaagaa ccccagttat tgcttcaagg gcaaagtggg       120
     catgatgtac agctaacacc ggcacaccgt aaagcaatta atgatgccac tttagtgatc       180
     tggttaggaa aagctcatga agctccgctc aacaaattgc taagtaacaa taagaaagca       240
     attgctttgt tagatagcgg tattctttct attttgccac agcgcaatac acgtggggct       300
     gctttaccaa atactgtaga tacgcatgtc tggctagaac caaacaatgc agtacgtatt       360
     ggctttttta ttgcagcttt acgttcacaa cagcatcctg aaaacaaagc gaagtattgg       420
     aataatgcga atacatttgc acgaaatatg ttacaggcgg ctcaagctta cgatagctca       480
     agcaacggta aaccgtattg gtcttatcat gatgcttatc aatatttgga gcgttcgcta       540
     aacttaaagt ttgctggtgc cttaacggat gacccgcatg tagctcctac agcggcacaa       600
     ataaagtacc ttaatgatag tcgaccaaaa gctcagatgt gtttacttgc agaaagtttt       660
     acaacaaaag ggcaatatca aaaactgggt agtattacct tccaacccgt tgatgaaagt       720
     atgaataatg aagataattt tgtaacagca tggaagaaac tggcgataaa aaccgataaa       780
     tgtgtattaa atacgcaaaa gtga                                              804
//

If you have problems or comments...

PBIL Back to PBIL home page