(data stored in ACNUC29543 zone)

EMBL: CP000521.PE143

CP000521.PE143       Location/Qualifiers
FT   CDS_pept        170952..171350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0147"
FT                   /product="ATP synthase protein I"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10630"
FT                   /protein_id="ABO10630.2"
FT                   /translation="MSQTSRLIDRRLAKALVFLQACMIPVSALVAWSIKDMTAALSAAL
FT                   GALVCWLATSYFAWQSFRTAGARASKQVLSNMYRGMLGKFAIMIVGFILILSNVKPLSP
FT                   LALLFGFILVQAMSWVAPFWVSRLQKRV"
     atgagccaaa ctagtcgctt gattgaccga cgattagcaa aagctttggt cttcttacaa        60
     gcatgcatga tccctgtttc cgcacttgtg gcgtggagca taaaagacat gacagcagca       120
     ttaagtgcgg cacttggtgc attggtctgc tggcttgcta cgagctattt tgcgtggcaa       180
     tccttcagaa ctgcaggtgc gagagcatct aaacaagtgc tgtctaacat gtataggggc       240
     atgttaggca aatttgcaat catgatcgtt ggatttattt tgattttgag caatgttaaa       300
     cctttatcac cgttagcatt gctgtttggt tttattctcg ttcaagcgat gtcgtgggtt       360
     gctccttttt gggtgtcacg tctacaaaaa cgggtatag                              399
//

If you have problems or comments...

PBIL Back to PBIL home page