(data stored in ACNUC29543 zone)

EMBL: CP000521.PE145

CP000521.PE145       Location/Qualifiers
FT   CDS_pept        complement(171598..171723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0149"
FT                   /product="membrane-bound ATP synthase F0 sector, subunit a"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10632"
FT                   /protein_id="ABO10632.1"
FT                   /translation="MIISIADWNFVGTPAFAALATIQNNKQKITPRPIDQPIESK"
     atgatcattt caattgcaga ttggaatttt gttggaacgc cagcatttgc agctctcgca        60
     actatccaaa ataacaaaca gaaaatcaca ccaaggccaa ttgaccaacc cattgaatcc       120
     aagtga                                                                  126
//

If you have problems or comments...

PBIL Back to PBIL home page