(data stored in ACNUC29543 zone)

EMBL: CP000521.PE152

CP000521.PE152       Location/Qualifiers
FT   CDS_pept        176287..177681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0155"
FT                   /product="membrane-bound ATP synthase F1 sector,
FT                   beta-subunit"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10638"
FT                   /db_xref="GOA:A3M144"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3M144"
FT                   /protein_id="ABO10638.2"
FT                   /translation="MSSGRIIQIIGAVIDVEFERTSVPKIYDALQVDGTETTLEVQQQL
FT                   GDGVVRTIAMGSTEGLKRGLTVTSTNAPISVPVGTATLGRIMDVLGRPIDEAGPVATEE
FT                   RLPIHRQAPSYAEQAASTDLLETGIKVIDLLCPFAKGGKVGLFGGAGVGKTVNMMELIN
FT                   NIAKAHSGLSVFAGVGERTREGNDFYHEMKDSNVLDKVAMVYGQMNEPPGNRLRVALTG
FT                   LTMAEYFRDEKDENGKGRDVLLFVDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEMG
FT                   VLQERITSTKSGSITSIQAVYVPADDLTDPSPATTFAHLDATVVLSRDIASSGIYPAID
FT                   PLDSTSRQLDPLVVGQEHYEIARAVQNVLQRYKELKDIIAILGMDELAEEDKLVVYRAR
FT                   KIQRFFSQPFHVAEVFTGAPGKLVPLKETIRGFKGLLAGEYDHIPEQAFYMVGGIDEVI
FT                   AKAEKL"
     atgagtagcg gtcgtatcat tcagatcatc ggcgcggtta tcgacgtcga gtttgagcgc        60
     acaagcgttc caaagatcta tgacgctctc caagttgacg gtactgaaac tactttagaa       120
     gttcagcaac aacttggtga tggtgttgtt cgtaccatcg caatgggttc tacagaaggt       180
     cttaaacgtg gtcttactgt aactagcaca aacgcaccga tctctgttcc agttggtaca       240
     gccactcttg gccgtatcat ggacgtttta ggtcgtccta tcgatgaagc aggtcctgtt       300
     gcgactgaag aacgtttgcc gattcaccgt caagcgcctt cttatgctga acaagcagct       360
     tctactgacc ttttagaaac tggtattaaa gtaattgact tactttgccc gtttgcgaaa       420
     ggtggtaaag ttggtttatt cggtggtgct ggtgttggta aaaccgttaa catgatggaa       480
     ttgatcaaca acatcgcgaa agcacactca ggtttatctg tgtttgctgg tgttggtgag       540
     cgtactcgtg aaggtaatga cttctatcac gaaatgaaag attctaacgt tcttgacaaa       600
     gtagcaatgg tctacggtca gatgaacgag ccaccaggta accgtttacg cgtagcgtta       660
     actggtttga ctatggctga atacttccgt gatgaaaaag acgaaaacgg taaaggtcgt       720
     gacgtattat tattcgtcga caacatctac cgttatacac ttgcaggtac tgaagtatca       780
     gcattgttag gtcgtatgcc atctgcggta ggttaccaac ctacacttgc agaagaaatg       840
     ggtgttcttc aagagcgtat tacatctact aaatctggtt cgatcacttc gatccaagca       900
     gtatatgtac ctgccgatga cttaacagac ccatcgcctg caactacatt tgctcactta       960
     gacgcaacag tagtattgag ccgtgacatc gcatcttctg gtatctatcc agcgatcgat      1020
     ccacttgact caacttcacg tcagttagac ccattagttg ttggtcaaga gcactatgaa      1080
     attgcgcgcg cagtacaaaa cgtattgcaa cgctataaag agcttaaaga catcatcgca      1140
     atcttgggta tggatgaatt ggcagaagaa gataaattgg ttgtttaccg tgcgcgtaaa      1200
     atccaacgtt tcttctctca accattccac gtagctgaag tatttactgg tgctcctggt      1260
     aaattagtac cacttaaaga aacgattcgt ggctttaaag gtctattagc tggtgaatac      1320
     gatcacatcc cagaacaagc gttctatatg gttggtggta ttgacgaagt gattgctaaa      1380
     gctgagaaac tctaa                                                       1395
//

If you have problems or comments...

PBIL Back to PBIL home page