(data stored in ACNUC29543 zone)

EMBL: CP000521.PE153

CP000521.PE153       Location/Qualifiers
FT   CDS_pept        177699..178118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0156"
FT                   /product="membrane-bound ATP synthase F1 sector,
FT                   epsilon-subunit"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10639"
FT                   /db_xref="GOA:A3M145"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR036771"
FT                   /db_xref="InterPro:IPR036794"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3M145"
FT                   /protein_id="ABO10639.2"
FT                   /translation="MATMQCDVVSVKESIYSGAVTMLIAKGAGGELGILPGHAPLVTLL
FT                   QPGPIRVLLENGTEEIVYVSGGVLEVQPHVVTVLADTAIRADNLDEAAILEARKNAEQL
FT                   LANQKSDLDSAAALAALAETAAQLETIRKIKNRAQ"
     atggcgacta tgcaatgtga tgtcgtaagt gttaaagagt caatttactc tggcgcagtg        60
     acgatgttaa tcgcgaaagg tgcaggtggt gaacttggta ttttgcctgg tcacgctcca       120
     cttgtaacct tgcttcaacc gggcccgatt cgtgttctgt tggaaaatgg tacagaagaa       180
     atcgtctatg tatctggcgg tgttttagaa gttcaacctc atgttgtgac agttcttgca       240
     gatactgcaa tccgcgctga caatttggat gaagctgcaa ttttagaagc acgtaaaaat       300
     gctgaacaat tgcttgcaaa ccaaaagagt gatttggact cagctgctgc gttggctgcc       360
     ttggcagaaa ccgctgcaca gcttgaaact atccgtaaaa tcaaaaaccg cgctcaataa       420
//

If you have problems or comments...

PBIL Back to PBIL home page