(data stored in ACNUC29543 zone)

EMBL: CP000521.PE155

CP000521.PE155       Location/Qualifiers
FT   CDS_pept        complement(178790..179389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0158"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10641"
FT                   /protein_id="ABO10641.2"
FT                   /translation="MKKVLQGAFFPFVIFASGMLLLGCDQAQDHSKEQESVQTNDQISE
FT                   QADDSQQEITATQNKTELKNGNVFYIVRDAANLQLKAGDYIEKLKDTQLDVEQAIQDKD
FT                   QHELKTTVTTLKAQLEGLNQALLGLDIRSQEVENIRQSLLQANQQALSMPLLNGKLEQI
FT                   NFDQIEKQLNTIQMDMVKLAAMIMAGDEKSDSKTDS"
     atgaagaaag ttttacaagg tgcatttttc ccatttgtga tttttgcttc aggtatgtta        60
     ttacttggat gtgatcaggc acaagaccac tcaaaggaac aagaatccgt tcagactaac       120
     gatcaaatat cagaacaagc tgatgactct caacaagaaa tcacagctac acaaaataaa       180
     actgaattaa aaaatggtaa tgttttttat atcgttcgtg atgccgctaa cttacagtta       240
     aaggctggcg actatatcga aaagctcaag gacactcaac ttgacgttga acaagctatt       300
     caagataaag atcagcatga gctaaaaaca actgtgacga ctttgaaagc acagttagaa       360
     ggtttaaacc aagctttact tggtttagat atcagaagtc aggaagttga aaatatccgt       420
     caaagcctac tacaggcaaa ccagcaagct ttaagcatgc ctttattaaa tgggaaatta       480
     gagcaaatta atttcgacca aattgaaaag caacttaata ccatccaaat ggatatggtc       540
     aagctcgctg ctatgattat ggcaggagat gaaaaatcag attcaaaaac tgattcttaa       600
//

If you have problems or comments...

PBIL Back to PBIL home page