(data stored in ACNUC29543 zone)

EMBL: CP000521.PE160

CP000521.PE160       Location/Qualifiers
FT   CDS_pept        183252..183554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0163"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10646"
FT                   /protein_id="ABO10646.1"
FT                   /translation="MTPFMFLSVWRQRRLVIPYLPKLAVLSAFGMVLYQGLAYTAAHYT
FT                   SATNMGIVNAFIPIFTIFVSLAILKDVPNRFAVFGSILSFAGLLYVMSQGILISF"
     ttgactccat ttatgttttt gtctgtttgg agacaaagac gactagtaat accctattta        60
     cctaagcttg ctgtgttaag tgcatttggg atggtgcttt atcaaggctt ggcttatacg       120
     gctgcccatt atactagtgc aaccaatatg gggattgtga atgcatttat tcccatcttt       180
     acgatctttg tttcgcttgc cattttaaaa gatgtgccta atcgctttgc agtttttggc       240
     agtattttgt cttttgctgg tctgctatac gttatgtccc aaggaatatt aataagcttt       300
     taa                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page