(data stored in ACNUC29543 zone)

EMBL: CP000521.PE161

CP000521.PE161       Location/Qualifiers
FT   CDS_pept        183656..184015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0164"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10647"
FT                   /protein_id="ABO10647.1"
FT                   /translation="MTSLYVQIGFSVLFHLPLIFWFGLDALNAQNAPSAIYAGVFASLI
FT                   APLVWMLAVQQLGPNRTSIFMNLVPVFTAIIASIWLSEQWTIYHTFGGIMILVGIIMAQ
FT                   KKVNSKKSDLLPEQN"
     atgacaagct tatacgttca gattgggttt tccgtgctgt tccatcttcc tttaattttc        60
     tggtttggtc tggatgcctt aaatgcacaa aatgcgccaa gtgcaattta tgccggtgta       120
     tttgcttcac tcattgcgcc gctagtttgg atgttagccg tacaacaact tgggccaaat       180
     agaaccagta tctttatgaa tcttgtgcca gtgttcaccg ccattattgc aagtatctgg       240
     ttatctgaac aatggaccat atatcacacc ttcggcggaa ttatgattct ggtgggcatt       300
     atcatggcac aaaagaaggt taattctaaa aaatcagatc ttttgccaga gcaaaattaa       360
//

If you have problems or comments...

PBIL Back to PBIL home page