(data stored in ACNUC29543 zone)

EMBL: CP000521.PE164

CP000521.PE164       Location/Qualifiers
FT   CDS_pept        complement(186178..187332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0167"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10650"
FT                   /protein_id="ABO10650.2"
FT                   /translation="MKKVFNGMVNFHALGIKKHLLALALCTGVAIGTIAEVHATSPNHN
FT                   PPSLKSNAPNVYVVKRGDTLWDISGHFLNKPWRWPEIWASNQHVKNPHWIYPGDRLLLC
FT                   SLDGRPLVGKDEGDGCVGIIRRYTGQTTNLQPQVRVEALNNSVPVIPLEHIKQWLENST
FT                   ILPADSITNTPYIVGTADQRVLAGKGQTIYARGQGLINGQRYAVYREGEPYYFTDNKGK
FT                   KHSLGIELLQVASGVAVSSEKDITTLELTDSYNAEVRRGDRVMPEEQATLPTLFYPVDA
FT                   KQVTDGGKIIRVMGSIGRAAKNSVVTLDRGTTQGVQVGQVFDITQQGESIRDPKTKEVI
FT                   QLPGQQIGSLMVFRTFDQLSYAYVLESDLPIKVGSSIQPPQFND"
     atgaaaaagg tttttaacgg catggttaat tttcatgcct tggggataaa gaagcattta        60
     cttgctttgg cgctctgtac aggtgtcgca atcggtacga tagcagaggt tcatgcaacc       120
     agtccgaacc ataatccacc ctcccttaaa agtaatgcac ccaatgtata tgttgtaaag       180
     cgtggggata ctttatggga tatttcagga cattttctaa ataaaccatg gcgttggcct       240
     gaaatctggg cgagcaacca acatgttaaa aatccacact ggatctatcc gggtgaccga       300
     ttactattat gtagcctaga tgggcgtcct ttagtcggta aagatgaggg ggacggctgt       360
     gtcggtatta tccgtcgcta tacaggtcaa accacaaacc tacaaccaca agttcgcgtc       420
     gaagcattaa ataatagcgt tccggttatt ccacttgaac atattaaaca gtggttagag       480
     aacagtacta ttttaccagc cgactcaatt accaatacac cttatattgt tggtacagcc       540
     gatcaacgtg tacttgcagg aaaaggccag actatttatg cacgaggaca aggcttaatt       600
     aatgggcagc gttatgcagt ctaccgagaa ggtgaacctt actatttcac agacaataaa       660
     ggtaaaaagc atagtttagg gattgagtta ctacaagttg cttcaggtgt tgcggtatct       720
     tctgaaaaag atattactac attagaacta acagatagtt ataacgctga agtacgtcgt       780
     ggcgatcggg ttatgcctga agagcaagct actttgccaa cattatttta cccagtagat       840
     gcgaagcaag tgacggatgg tggcaagatt attcgtgtca tgggctcaat tggtagagct       900
     gcaaaaaata gtgtagtgac tttggatcgc ggtacaactc agggcgttca agtaggccaa       960
     gtttttgata ttactcaaca aggtgaatca attcgcgacc ctaaaaccaa agaagtaatt      1020
     caacttcctg gccaacaaat tggcagtcta atggttttta gaacttttga tcagctaagt      1080
     tatgcttatg ttttagagag cgatttacca attaaggttg gttcaagcat tcagccacct      1140
     caatttaatg attaa                                                       1155
//

If you have problems or comments...

PBIL Back to PBIL home page