(data stored in ACNUC29543 zone)

EMBL: CP000521.PE165

CP000521.PE165       Location/Qualifiers
FT   CDS_pept        187455..187985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0168"
FT                   /product="Zinc(II) binding peptide deformylase 1"
FT                   /note="N-formylmethionylaminoacyl-tRNA deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10651"
FT                   /protein_id="ABO10651.2"
FT                   /translation="MALLPILSFPDPRLRTIAKPVEEVTDEIRQLAADMFETMYAAPGI
FT                   GLAASQVDRHIQLIVMDLSESKDEPMVFINPKVTPLTEETQPYEEGCLSVPQIYDKVDR
FT                   PSRVKIEAINLEGQAFEIEADGLLAVCIQHEMDHLNGKLFVDYLSPLKRQRAREKVEKI
FT                   VRQREREKVAVKR"
     atggccttat tacctatttt aagttttcct gatccccgtc ttcgtaccat tgctaagccc        60
     gttgaagaag ttactgatga aattcgtcaa cttgcagcag atatgtttga aaccatgtat       120
     gcggcaccag gtatcggttt agcagcttct caggtcgatc gtcatattca gcttatcgtc       180
     atggatttgt ctgaatctaa agatgaacct atggttttca ttaaccccaa agtaactccg       240
     ctgactgaag agacgcagcc gtacgaagaa ggctgtctat cagtgccaca aatatacgac       300
     aaagttgatc gcccgtcacg cgtgaaaatt gaggcaatta accttgaagg tcaagcattt       360
     gagatagaag ctgacggact tctcgctgtt tgtatccaac atgaaatgga tcacttaaat       420
     ggcaaattgt ttgtggatta tttgtcgcca cttaagcgtc agcgtgcgcg tgaaaaagtc       480
     gaaaaaattg ttcgccaacg cgaacgtgaa aaagttgcgg taaaacgtta a                531
//

If you have problems or comments...

PBIL Back to PBIL home page