(data stored in ACNUC29543 zone)

EMBL: CP000521.PE166

CP000521.PE166       Location/Qualifiers
FT   CDS_pept        188148..188450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0169"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10652"
FT                   /protein_id="ABO10652.1"
FT                   /translation="MLKPKAQTEAMSHAMHHSHHQHHIEQAQVPDHHDHHDANHQCQYC
FT                   TVYANLVLPPEFGVKEVLVRIQVRLVAYQQAFRHVYFALQRLFLLPQGRAPPLFA"
     ttgcttaaac ctaaagcaca gacggaagcc atgtcacatg ccatgcacca ttcacatcac        60
     cagcatcata tcgaacaggc gcaagtacct gaccatcatg atcaccatga tgcaaaccat       120
     cagtgtcaat attgtaccgt ttatgccaat ttggttttac cacctgaatt tggcgtaaaa       180
     gaggtgcttg ttcgtataca agttcgctta gtcgcgtatc aacaagcttt ccggcatgtt       240
     tactttgcgc tacagcgact tttcctactc ccgcaaggac gtgcgccgcc tctatttgca       300
     taa                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page