(data stored in ACNUC29543 zone)

EMBL: CP000521.PE17

CP000521.PE17        Location/Qualifiers
FT   CDS_pept        complement(21894..22121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3478"
FT                   /old_locus_tag="AS1_3478"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3478"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89903"
FT                   /protein_id="ABS89903.1"
FT                   /translation="MNSKFSVDQSNKISLKAVLEDLGDQMFEANKCPDTHPVYDQLRER
FT                   LRKDRQLLDALDAQDENANTEERSRSLDIN"
     atgaatagca aattttctgt tgatcaatcg aacaagattt ctcttaaagc agtgcttgaa        60
     gatcttggtg atcaaatgtt tgaagcaaat aaatgtcctg atactcatcc tgtctatgat       120
     cagttgcgtg agcgtttacg taaagatcgt caacttctag atgccttaga tgctcaagat       180
     gagaacgcaa atactgaaga acgttctagg agtttggata taaattaa                    228
//

If you have problems or comments...

PBIL Back to PBIL home page