(data stored in ACNUC29543 zone)

EMBL: CP000521.PE176

CP000521.PE176       Location/Qualifiers
FT   CDS_pept        complement(202105..202590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0180"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10661"
FT                   /protein_id="ABO10661.2"
FT                   /translation="MNTSTLFFQALCLGIGATIVMDIWLLILKIFKVPTLNFAFLGRWV
FT                   GWIFQGKLVHQSIAKSTPIKGEYLLGWIAHYSVGIIFALSFLLIVGSTWLDHPQFYSAL
FT                   LFGLVTVLIPFFIMQPAMGSGFASSKTPHPFLNCLKSLLNHSVFGCGLYLTAKLFQI"
     atgaatacat ccactctgtt ctttcaagct ttatgtcttg gtattggtgc aaccatcgtt        60
     atggatatat ggctgttaat actaaaaata tttaaggtcc cgactttaaa ctttgccttt       120
     cttggacgtt gggtgggctg gatatttcaa ggaaaactcg tccatcaatc tattgctaaa       180
     agtaccccaa taaaggggga atatttatta ggctggattg ctcactatag tgtcgggatt       240
     atcttcgcat tgagctttct tttaattgta ggttcgactt ggctcgacca ccctcagttt       300
     tactcagcac tactgtttgg tttggtcacc gttctcattc ctttttttat tatgcaacca       360
     gctatgggta gtggttttgc ctcatcaaaa acacctcatc cttttttgaa ctgtctgaaa       420
     agtttgctga accatagtgt ttttggctgt ggtttatatc tcactgcaaa actatttcaa       480
     atttaa                                                                  486
//

If you have problems or comments...

PBIL Back to PBIL home page