(data stored in ACNUC29543 zone)

EMBL: CP000521.PE178

CP000521.PE178       Location/Qualifiers
FT   CDS_pept        203224..204483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0182"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10663"
FT                   /protein_id="ABO10663.2"
FT                   /translation="MSKKTLIALLCCASLGLTACNDDNDQDQTSPTENVTEPTLISFAK
FT                   LPVETYAAGPDSGAYVKGANGIYPPFKGQPVQGFSAALKNEDGSYMAMADNGFGTQDNS
FT                   SDFLLRIYKIKPDFKTKTKGTGQVTVQSFIQLRDPNKLIPFNIINGNTPERLLTGADFD
FT                   PESMQRTSDGTYWIGDEFGPYLLHFSADGVLLDAPIPLPNPLNPTQELRSPQNQFNKAQ
FT                   INFVEPLVQQSGGFEGMAISPDGQYLYPLIEKPIKSIRETERQLLISQFDIKKKAYTGK
FT                   YYWFQLDSKATNIGDFQLFNDKEGIIIERDATQNNLGGYKKLIRIKLNESGQLVSREDL
FT                   VDLIKIANPNMLYGTARAGDIGMGQVFAFPFETIEDVIIENGTTLTVFNDNNFPGSTGR
FT                   NAKLADDNEIIQIRLPKALF"
     atgagcaaaa aaactttaat cgcattatta tgctgtgcca gtttaggatt gacggcatgt        60
     aacgatgata acgatcaaga tcaaacttca cctactgaaa acgttaccga accaactcta       120
     atttcttttg ctaagttacc tgtagaaact tatgctgctg gaccagactc aggggcatat       180
     gtgaaaggtg caaatggaat ttatcctccg tttaaaggtc aacctgtaca gggattttct       240
     gctgcattaa aaaatgaaga tggcagttat atggcaatgg ccgataacgg ttttggaact       300
     caagataatt catcagactt tttacttcgt atttataaaa taaagcctga tttcaaaact       360
     aaaactaaag gcaccggtca agttactgta caaagtttta tccaactgcg tgatccgaat       420
     aaattaattc catttaatat catcaatggt aatacgcctg agcgtttatt aacgggtgct       480
     gattttgacc cagagtcgat gcagcgtact agtgatggga cttactggat tggagatgaa       540
     tttggtccat atttactcca tttctcagca gatggtgtac ttttagacgc tccgattcct       600
     ttaccaaatc cattaaatcc aactcaggaa ttacgttcac cacaaaatca atttaataaa       660
     gcacaaatta attttgtgga acctcttgtt caacaaagtg gcggttttga aggaatggcg       720
     atttcaccag atggacaata tctctatccg cttatagaaa agccaattaa atcaattcgg       780
     gaaacagaaa gacaactgtt gatttcccaa ttcgatatta agaaaaaagc gtatacagga       840
     aaatattatt ggttccagtt agacagtaaa gctaccaata ttggtgattt ccaactcttt       900
     aatgataaag aagggatcat tattgaacgt gatgccacgc agaataattt aggcggctat       960
     aaaaaattaa tccgtattaa attaaatgag tcaggccagt tggtcagccg cgaagactta      1020
     gtcgatttaa ttaaaattgc taacccgaat atgttgtatg gcacagctag agcaggggat      1080
     attggtatgg gacaggtttt tgccttccca tttgaaacca ttgaagatgt aattattgaa      1140
     aatggtacaa cactgacggt tttcaatgat aataacttcc ctgggtcgac gggacgtaat      1200
     gcaaagttgg ccgatgataa cgagattatt cagattcgtt taccaaaagc tctcttctaa      1260
//

If you have problems or comments...

PBIL Back to PBIL home page