(data stored in ACNUC29543 zone)

EMBL: CP000521.PE179

CP000521.PE179       Location/Qualifiers
FT   CDS_pept        204698..207076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0183"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10664"
FT                   /protein_id="ABO10664.2"
FT                   /translation="MSTAYTMQTAPKALFDYDKYWASCFEPAPFLPMSREEMDQLGWDA
FT                   CDFILVCGDAYIDHPSFVSGVIGRVLEAQGFRVGIIAQPDWTNVESFRVLGKPTIAWGV
FT                   TAGNMDSMINRYTADRKIRSDDAYSPNNEPNKRPDRAATVYCQRCREAFPDVPVLLGGI
FT                   EGSLRRIAHYDYWSDKVRRSILMDSKADMLMYGNGERAIIDVMHRLAKGEKIHEITDVR
FT                   GTAFIINKHNKAAKAKFVEIASNDVDTIGRVDPIINPYVMTEDIDGCEIEKDKGNTLAQ
FT                   YQGFQKEIVANPIVREGDQLDENTQIVQLKPAQSKAIKHKLPPRELAVIRLPSFEEVAN
FT                   DQVLYAHANRILHLETNPGNARALVQRHGERDVWINPPPIPLTTEEMDYVFDLPYARLP
FT                   HPAYGDARFPAFDMIKFSVNIMRGCFGGCTFCSITEHEGRIIQNRSEDSILREIEKIRD
FT                   TAPNFTGIISDLGGPTANMYRLHCKDPEIEKNCRKPSCVYPGVCQNLHTDHAPLVQLYR
FT                   KARAIKGVKKILIGSGLRYDLAVLNPEYVKELVQHHVGGYLKIAPEHTEQGPLSKMMKP
FT                   GIGTYDRFKQMFDRFSKEAGKEQYLIPYFIAAHPGTSDYDMMHLAIWLKKNGFRADQVQ
FT                   TFYPSPMATATTMYYSGKNPLAKVARYTENVDIVKGEKRRRLHKAFLRYHDPNNWPLLR
FT                   EALKEMGRADLIGNSKQHLIPTYQPKGAEGEYKSARKKNSTVAGDSVKRSGQTVQNKNQ
FT                   HKRPQKGQVLTQHTGLPPRETGEKRPFGGKSKPKSKARG"
     atgtctaccg cttatactat gcaaactgcg ccaaaagcgt tgtttgatta cgacaaatat        60
     tgggcgtcgt gttttgaacc agcgccattt ttgccgatgt cacgagaaga aatggaccaa       120
     ctcggctggg atgcgtgtga ctttatttta gtctgtggcg atgcttatat tgatcatcca       180
     tcctttgtat cgggtgtgat tggacgggta ttggaagcgc aaggtttccg tgtcggtatt       240
     attgcacagc cagactggac caatgttgaa agtttccgtg tattgggtaa gccaacgatt       300
     gcttggggag tgactgcggg caatatggat tcgatgatca accgctatac ggcagatcgt       360
     aaaatccgtt cggatgatgc atattctcca aacaatgaac caaataaacg ccctgaccgt       420
     gcggcaacgg tttattgcca acgttgtcgt gaagcattcc cagatgtacc agtactatta       480
     ggtggtattg agggtagttt acgtcgtatt gcgcactatg attattggtc agacaaagtc       540
     cgtcgttcaa ttttgatgga ttcaaaagcc gatatgctta tgtatggtaa tggtgaacgt       600
     gccattattg atgtgatgca ccgtttggca aaaggtgaaa aaatccacga aattacagat       660
     gttcgtggta cagcatttat tattaataaa cataacaaag cggctaaagc aaaatttgtt       720
     gaaattgcca gtaatgatgt agatacgatt gggcgtgttg acccaattat taacccctat       780
     gtcatgactg aagatattga tggttgtgaa attgagaaag ataaaggcaa cacactagct       840
     caatatcaag gttttcaaaa agaaattgtt gcaaatccga ttgtacgtga aggcgaccaa       900
     cttgatgaaa atactcagat tgttcagcta aagcctgctc agtcaaaagc gattaaacac       960
     aagttacctc cgcgagaatt ggctgtaatt cgtttacctt cttttgaaga agtggcaaat      1020
     gatcaagtgc tttatgcaca tgcaaaccgt attttgcacc ttgaaaccaa cccgggtaat      1080
     gcacgtgctt tggttcaacg tcatggtgag cgtgatgtct ggatcaatcc acctccaatt      1140
     ccgctaacca cagaggaaat ggattatgta tttgatttgc catatgcacg tttgccgcat      1200
     cctgcatatg gagatgcgcg tttccctgca tttgatatga tcaaattctc ggtcaacatt      1260
     atgcgtggct gttttggtgg ttgtacattc tgttcgatta cagaacatga aggccgtatt      1320
     atccaaaacc gttcggaaga ttcgatctta cgtgagatcg agaaaattcg tgatacagcg      1380
     ccgaacttca ccggtattat ttcagactta ggtggtccaa cagcaaacat gtaccgtttg      1440
     cattgtaaag accctgaaat tgagaagaac tgtcgtaaac cttcttgtgt atatccgggt      1500
     gtttgtcaaa acttgcatac cgatcatgca cctttagtac agctttatcg taaagcacgt      1560
     gcgattaaag gggtgaagaa gattctgatt ggatcgggat tacgttatga ccttgcagta      1620
     ttgaaccctg aatatgtcaa agagctagta caacatcacg ttggcggtta tttaaaaatt      1680
     gcaccagagc atactgaaca aggcccgtta tctaagatga tgaaaccggg tattggtacg      1740
     tatgaccgtt tcaaacaaat gtttgatcgc tttagtaaag aagcaggaaa agagcaatat      1800
     ttaattcctt actttattgc tgcacaccca ggtacttctg attatgacat gatgcatctt      1860
     gcgatctggc tgaagaagaa tggtttccgt gccgatcagg tacagacgtt ctacccatca      1920
     ccgatggcaa ctgcgacaac catgtattat tcagggaaaa acccactcgc aaaagtggcg      1980
     cgttacactg aaaatgtaga cattgtaaaa ggtgaaaaac gccgtcgtct gcacaaagca      2040
     ttcttacgtt accatgatcc aaataactgg ccattacttc gtgaagcact taaagaaatg      2100
     ggccgtgctg atttaattgg taattcaaag caacatttaa ttccaactta tcaaccgaaa      2160
     ggggcggaag gagaatataa atctgcacgt aagaagaact cgactgttgc gggcgattca      2220
     gtgaagcgtt caggtcaaac agttcaaaat aaaaatcagc ataaacgacc gcaaaaaggg      2280
     caggtactga ctcaacatac gggtctacca cctcgtgaga caggcgaaaa gagaccattt      2340
     ggtggtaaaa gtaaaccaaa atcaaaagct cgtggataa                             2379
//

If you have problems or comments...

PBIL Back to PBIL home page