(data stored in ACNUC29543 zone)

EMBL: CP000521.PE182

CP000521.PE182       Location/Qualifiers
FT   CDS_pept        complement(208493..208600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3489"
FT                   /old_locus_tag="AS1_3489"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3489"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89914"
FT                   /protein_id="ABS89914.1"
FT                   /translation="MPKQPLLSAYRPVIGVTTKSEYYRALKVHGACPFL"
     atgccaaagc aacctttact ttcggcatat cgtcctgtga ttggcgtgac gaccaaatcc        60
     gaatattaca gggcacttaa agtacatgga gcttgcccat tcttataa                    108
//

If you have problems or comments...

PBIL Back to PBIL home page