(data stored in ACNUC29543 zone)

EMBL: CP000521.PE186

CP000521.PE186       Location/Qualifiers
FT   CDS_pept        complement(212192..212815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0189"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10670"
FT                   /protein_id="ABO10670.2"
FT                   /translation="MNSVLTMAVNDSPITSVKTTQPLIALYCGSRAGNNPIYREKAIEL
FT                   ASGIAEQGFGLVYGGASIGLMGQVAESVLAHGGEAVGVIPEFMLDYEVAHAGLTELHVV
FT                   ETMHERKAMMAERASAFIALPGGLGTFEEILEIATWGQLNQHQKPMILYNVNGFYNALI
FT                   AQLDHAVQEGFLPLQHRAKLIVCEEIDQIYNVIKNLKMPKRFVV"
     atgaatagcg tattaacaat ggcagtaaat gattcaccaa taacatctgt aaaaacaaca        60
     caacctctta ttgcattata ttgtggctca cgagcaggaa ataacccgat ttatcgagaa       120
     aaggcaattg aattagccag tggaattgct gaacaaggtt ttggtttggt ctacggcggg       180
     gccagtattg gtttaatggg gcaagtcgca gaaagcgtac ttgcacatgg tggagaagct       240
     gtaggggtca ttcctgaatt tatgcttgat tatgaagtgg cgcatgcagg actgaccgag       300
     ttgcatgtgg tagaaaccat gcatgagcgt aaagccatga tggcagagcg cgcgagtgct       360
     tttatcgcgc tacctggcgg tttaggtaca ttcgaagaaa ttttggaaat tgcgacttgg       420
     ggtcaactca atcagcatca aaaacctatg attttatata acgtaaatgg tttttataat       480
     gcattaattg ctcagttaga ccacgctgta caagaaggct ttcttcctct tcagcatcga       540
     gctaaattaa ttgtatgtga agaaatcgac caaatttata acgtcattaa aaacttaaaa       600
     atgccaaaga gatttgttgt ttaa                                              624
//

If you have problems or comments...

PBIL Back to PBIL home page