(data stored in ACNUC29543 zone)

EMBL: CP000521.PE187

CP000521.PE187       Location/Qualifiers
FT   CDS_pept        213142..214734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0190"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10671"
FT                   /protein_id="ABO10671.2"
FT                   /translation="MIFEWMSDPSAWVGLATLIVLEIVLGIDNLVFIAILAEKLPPEQR
FT                   TKARIVGLILALGMRLILLASIAWVVTLTQPLFHIFSHPFSGRDLILLFGGVFLLFKGT
FT                   MELHERMEGKQLHKEDNPVHAAFWMVIVQIVVLDAVFSLDSVITAVGMVKELSVMMVAV
FT                   VIAVGIMLWASRPLMDFVNKHPTVVILCLGFLMMIGFSLVVEGFGFHIPKGYLYAAIGF
FT                   SILVEMINQTMRRNQEKLVTTTDLRYRTASAVLRMLGSKNSGSTSDAQTADKEDVLATQ
FT                   AFADEVFDEENGAYHSVLVQGVLGLSERPVKSVMTPRPELEWIDLDEEPEVLKERLMSM
FT                   THSRLIVARGELDNIEGIALTHKVLNGFIETGVIDFQKHLREPVIVHENAQVLMVMEQL
FT                   RQAPLQMAIVLNEYGSIEGIATPIDILEAIAGEFPDEDELDAAAESLEDGSLILEGSTD
FT                   IRHVSLLLGRDLVDESEQYSTLSGYLLFHLGRLPENGETVEADGYRFEVVTMEGHKIEK
FT                   VHIVSIEQDESKD"
     atgatctttg aatggatgtc tgatccgtct gcttgggtag gcctagcgac attaattgtt        60
     cttgaaatcg tactagggat cgataacctc gtctttattg ccattttggc tgaaaagctg       120
     ccaccagaac aacgtactaa ggcacgtata gtgggtttaa tactcgcttt gggaatgcgt       180
     cttatcctct tagcttcaat tgcttgggtc gtgacactca cccaaccact tttccatatt       240
     tttagccatc cattctctgg ccgtgatttg attttattgt tcggtggtgt gttcttgctc       300
     tttaaaggca ccatggaatt gcatgagcgg atggaaggta aacaacttca taaagaagat       360
     aatcctgttc atgctgcgtt ctggatggtc atcgttcaga ttgttgtgct tgatgccgta       420
     ttctcattag acagcgtaat tactgctgta ggtatggtga aagaactgtc agtcatgatg       480
     gttgctgttg tgattgctgt gggtattatg ctgtgggctt caagaccact catggacttt       540
     gtgaataaac acccaacagt agttattcta tgtcttggct tcttgatgat gattggtttc       600
     tctttggtgg tggaaggttt tggtttccat attccgaagg gttatttata tgctgcgatt       660
     ggtttctcaa ttttagtcga aatgatcaac caaaccatgc gtcgcaacca agagaagcta       720
     gtgactacta cagatttacg ttatcgcaca gcttctgcgg ttttacgtat gttaggcagt       780
     aaaaatagcg gttctacttc agacgctcaa acggctgata aagaagatgt attggcaact       840
     caagcttttg ctgatgaagt ctttgatgaa gaaaatggcg cttaccatag tgtgcttgta       900
     caaggtgtac ttggtttatc tgaacgtcca gtaaagtcag tgatgacacc aagacctgag       960
     cttgaatgga ttgatttaga cgaagaacca gaagttttaa aagaacgttt aatgtcgatg      1020
     acacattcac gtttaattgt tgctcgtggt gaacttgata atattgaagg tattgcgctt      1080
     acacataaag ttttaaatgg ctttattgaa acaggcgtta tcgattttca aaagcactta      1140
     cgtgagccag ttattgtgca tgaaaatgct caagtgctta tggtgatgga gcaattacgt      1200
     caggctcctt tacaaatggc gattgttcta aatgaatatg gttcaattga aggtattgcc      1260
     acaccaattg atattttaga agcaattgcg ggtgagttcc ctgatgaaga cgaactagat      1320
     gcagcagcag aaagtttaga agacggttcg ttaatacttg agggttcaac cgatattcgt      1380
     catgtatcgc ttttacttgg acgtgactta gttgatgaaa gtgaacaata ttctacttta      1440
     tcgggctatt tgttattcca tttaggccgt ttacctgaaa atggtgaaac tgttgaagcg      1500
     gatggttatc gctttgaagt tgtaaccatg gaaggccata aaatcgagaa agttcatatt      1560
     gtttctatcg aacaggatga atcgaaagat taa                                   1593
//

If you have problems or comments...

PBIL Back to PBIL home page