(data stored in ACNUC29543 zone)

EMBL: CP000521.PE188

CP000521.PE188       Location/Qualifiers
FT   CDS_pept        214806..215273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0191"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10672"
FT                   /protein_id="ABO10672.2"
FT                   /translation="MTQQTCPCGKGSYAECCEPLHLGTTKALTAEQLMRSRYSAFALQQ
FT                   IDYIVQTTALGQQTALDKEAIAEWSKQNQWLGLEVVNANKKLDKTHAQVEFKAHYHDGK
FT                   SAQIHHEVSHFVFHQQQWFFLDPTVDMQVTMKQPCICGSGKKIKQCCAQFL"
     atgacccaac aaacttgtcc atgcggaaaa ggcagctatg cagaatgttg tgaaccttta        60
     catttaggca caacaaaagc actcaccgca gagcagctta tgcgttcacg ttatagtgca       120
     tttgcattgc agcaaattga ttatattgtg caaacgacgg ctttaggtca gcaaactgct       180
     cttgataaag aggctattgc ggaatggagc aaacaaaatc aatggttggg tttagaggtg       240
     gttaacgcca acaaaaaatt agataaaacc catgcacagg tagagttcaa ggcccattat       300
     catgatggta aaagcgctca aattcatcat gaagtttcac attttgtatt tcatcagcaa       360
     caatggtttt tccttgatcc gacggtcgat atgcaggtca ccatgaaaca accttgtata       420
     tgtggttcag gaaaaaaaat taagcaatgc tgtgcacaat tcctataa                    468
//

If you have problems or comments...

PBIL Back to PBIL home page