(data stored in ACNUC29543 zone)

EMBL: CP000521.PE191

CP000521.PE191       Location/Qualifiers
FT   CDS_pept        complement(221758..222141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0198"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10675"
FT                   /protein_id="ABO10675.1"
FT                   /translation="MQQPDQKELFEVLEKQKNNQLQVDRIFKIVLPIVAFLLSVICANF
FT                   NWQSTLGTFVILTVTFMAVGVKRLPLWHWLIVITIYCLVDNYLSYGQLDVTHLRLQLGT
FT                   MLVFVGMVGIGRPYVDRWFMKNH"
     atgcaacaac ctgatcaaaa agaattgttc gaggtcttag aaaagcaaaa gaataaccag        60
     cttcaggtag atcgtatatt caaaattgta ttaccgatcg tcgctttttt actgagtgta       120
     atttgtgcga attttaattg gcaatctaca ctgggtacct tcgtgatctt aacagtgacc       180
     tttatggctg taggtgtcaa aagacttcct ttgtggcact ggctcattgt gattaccata       240
     tattgtcttg tagataatta cctcagttat ggtcaacttg atgtaactca cttacgtcta       300
     caactcggta ccatgttagt ttttgttggt atggtcggaa ttggtcgccc ttatgtagat       360
     cgttggttta tgaaaaacca ttaa                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page