(data stored in ACNUC29543 zone)

EMBL: CP000521.PE192

CP000521.PE192       Location/Qualifiers
FT   CDS_pept        222248..222646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0199"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10676"
FT                   /protein_id="ABO10676.2"
FT                   /translation="MHGISSIIYIILVACLLPYAFTVIAKFTGGFQPVDNQNPRDFLAN
FT                   TKGIAARANAVQQNSFESLPLFLTAILMAEYMVVPEYFILRLGWAYIILRVIYGICYLS
FT                   NWATLRSIVWFLSLLCPIFLLIVTIKLT"
     atgcacggca tcagcagcat tatctatatt attttagtgg catgtttgct gccatacgca        60
     tttaccgtga ttgcaaaatt taccggtggt tttcagcccg tcgataatca gaacccaaga       120
     gactttcttg ctaatacaaa gggtatcgct gctcgggcaa atgcagtaca acaaaacagt       180
     tttgaaagtt tacctttatt tttaacagct attttgatgg ctgaatatat ggtggttcct       240
     gaatacttta ttttaagatt gggctgggcc tatattattt tacgtgtgat ttatggcatt       300
     tgttacttaa gtaattgggc tactttacgc tctatcgtct ggtttttatc attgttatgc       360
     ccaatattct tgttgatcgt gacaattaag ttgacttga                              399
//

If you have problems or comments...

PBIL Back to PBIL home page