(data stored in ACNUC29543 zone)

EMBL: CP000521.PE196

CP000521.PE196       Location/Qualifiers
FT   CDS_pept        complement(226471..227355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0203"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10680"
FT                   /protein_id="ABO10680.2"
FT                   /translation="MKLNGIIGYPVTPFSDDNTTQSSCSKTNAGFRLIENRSATRLQPL
FT                   GSTGESAYLEWDEWCLVAKTSIESINKRVPVIIGISELTTNQAIKKAQIAQSYGADALM
FT                   VIPVSYWKLTDQEIFEYYQAIAQATTLPIMIYNNPATSGVDMSPELMVRMFNNIANIMM
FT                   VKESSGDIQRMHKIYELSKGELPFYNGCNPLALEALCAGASGWCTAAPNLLGQRPQQLI
FT                   EYVKNGELEQAQKSFYQQLPLLRFIVSGGLPKTIKAGLQLKGVAAGAPRKPLTKATDIE
FT                   LNQLKQLLSEIEN"
     atgaaattaa acggcattat tggctaccct gttactccct tttctgatga caacactact        60
     caatcttcct gttctaaaac aaatgctgga tttagactta ttgaaaatag gtctgcgacg       120
     cgattgcaac ctttaggcag tacaggtgaa agcgcttatc ttgaatggga tgaatggtgc       180
     ttagtcgcga aaacttcaat tgaaagcatt aataagcgcg tgcctgtcat tattggaatt       240
     tcagaactca cgactaatca agccatcaaa aaagctcaaa tcgcgcaaag ctatggtgca       300
     gatgcactta tggtgattcc tgtatcttat tggaagctaa cagaccaaga gatttttgaa       360
     tattaccaag caattgctca agcaacgact ttaccgatta tgatttataa taaccctgca       420
     accagtggtg ttgatatgtc tcctgaatta atggtgcgca tgtttaacaa cattgcaaat       480
     attatgatgg taaaagaaag cagcggcgat attcagcgca tgcataaaat ttatgagcta       540
     tcaaaaggtg aacttccgtt ttataacggc tgtaaccctc tagctttaga agctttatgc       600
     gcaggagcaa gcggttggtg tacagcagca cccaatctgt taggtcaacg acctcaacag       660
     cttattgaat atgtaaaaaa tggtgaattg gaacaagccc agaagtcatt ttatcagcag       720
     cttcctctat tacgctttat tgtaagtggt ggtctgccta aaacgattaa agcaggttta       780
     caactaaaag gtgtcgctgc aggagcacca cgcaagccgt tgaccaaagc cacggatatt       840
     gagcttaatc agttaaaaca actactttct gaaatagaaa actaa                       885
//

If you have problems or comments...

PBIL Back to PBIL home page