(data stored in ACNUC29543 zone)

EMBL: CP000521.PE198

CP000521.PE198       Location/Qualifiers
FT   CDS_pept        228259..229671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0205"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10682"
FT                   /protein_id="ABO10682.2"
FT                   /translation="MLRPWQIHFRIDEREEKTVFLKLTNLISQEILSGRLVQGTMLPGS
FT                   RSLSKELGINRKTVQAVYEELEAQGWLVTRPRKGTFVADVLPEKKPHIEPRADRKVSNK
FT                   PIIQQVAQRPHNDGVPDPRLIPYELFSRAYRHALIKITQNQYMGYGDPRGMAELRQALK
FT                   QMLSMERFMNVAEDEICVVRGSQMGIFLASRALPNRQGVIVVEELYYPSAVKAFQSNGF
FT                   QVVSVKLDDQGIVIEDLERILKEHSVAAIYTTPHHQYPTTVTMTMSRRLQLLELSKKWG
FT                   FYIIEDDYDHEFHYDSRPMPPLASLPHSELVIHVGSLSKVFAPGIRLGYIVAAPTIIQT
FT                   ITEDILLIDRQGNNITELALADLMQRGEIKRHIRKMKKIYQLRRDHALAEFQRVFAESI
FT                   EIQPPAGGMALWVKFQKSFTQDQLIKLKELNIDTEQKFKQKECANHCIRFGFAALSEKE
FT                   ITSLIETLNEAL"
     atgctaagac cttggcaaat acatttccgc attgatgaaa gagaagaaaa aacggttttt        60
     ctaaaactaa ctaacttgat tagtcaggaa attttgagtg gccgtttagt acagggcact       120
     atgctgccgg ggtctcgcag cctgtcaaaa gaattgggaa ttaatcgaaa aacggtacaa       180
     gcagtttatg aagaattgga ggcacaaggt tggcttgtga ctcggcctcg aaaaggcaca       240
     tttgtggcag atgttttacc ggaaaaaaag cctcatatag agccaagagc tgatcgaaaa       300
     gttagtaata aaccaataat tcaacaagtt gctcagcggc cccataacga tggtgtgcca       360
     gatccgaggc ttattcccta tgaattgttt tcgagggcct atcggcacgc actcattaaa       420
     attactcaaa accagtacat gggatatggt gacccacgcg gtatggctga actaaggcag       480
     gctttaaaac aaatgttgtc gatggaacgt tttatgaatg ttgcggaaga tgagatctgt       540
     gttgtacgtg gaagccagat gggaattttt cttgcctctc gagcattacc caatcggcag       600
     ggcgttattg tcgttgaaga gctgtattac ccatctgctg ttaaagcgtt ccaatcaaat       660
     ggctttcaag tggtttctgt caaattagat gatcaaggta ttgttattga agatcttgaa       720
     cggattttaa aagaacactc ggttgcagca atttatacaa cgccacatca tcagtaccct       780
     acaaccgtta ccatgacaat gagccgccgt cttcaactct tagagctttc aaaaaaatgg       840
     gggttttaca ttattgaaga tgactatgac cacgaattcc actatgacag ccggcctatg       900
     ccacccttag caagtttgcc ccattctgag ttggttattc atgtaggttc attgtctaaa       960
     gtttttgcac ccggtattcg gttaggttac atcgtggcag ctccaaccat cattcaaact      1020
     attactgaag atattttatt gattgatcgg cagggcaata atattacaga actcgcttta      1080
     gcagatttaa tgcaacgagg ggagatcaag cgtcatattc gtaaaatgaa aaagatttat      1140
     cagttacgtc gagaccatgc gttagctgag tttcaaagag tttttgctga aagtattgag      1200
     atacaaccgc ctgcgggtgg aatggctttg tgggtaaaat ttcagaaatc atttactcaa      1260
     gatcagctca taaagctaaa agaactcaac attgatacag agcagaagtt taaacagaaa      1320
     gaatgtgcta atcattgtat tcgctttggt tttgcagctt tatcagagaa agaaatcacc      1380
     tctctaattg agaccttaaa tgaagctctt taa                                   1413
//

If you have problems or comments...

PBIL Back to PBIL home page