(data stored in ACNUC29543 zone)

EMBL: CP000521.PE199

CP000521.PE199       Location/Qualifiers
FT   CDS_pept        230516..230968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0207"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10683"
FT                   /protein_id="ABO10683.1"
FT                   /translation="MKKLSDEYLPVRKAQTVYGSISGNYAFRGEKTIWFESTLERDFIL
FT                   KQEFNNNVIDVIGQPVVIPYITELGNQSTYTPDFLVQFSSSNCDDFEDFPVPMLIEIKP
FT                   KKKLVEDWDKLKPKFRAAHRFAADKGWKFKIISETRLYVGLTHYHL"
     atgaaaaaat tgagtgacga atacttacct gttagaaaag ctcaaactgt ttatgggagt        60
     atttcgggaa attatgcctt tagaggtgag aaaaccattt ggtttgaatc gacccttgag       120
     cgtgatttca tacttaagca agaatttaat aacaatgtga ttgatgttat cggtcaacct       180
     gtagttatcc cctacatcac tgaattgggt aaccaatcaa cctacactcc tgacttttta       240
     gtgcagtttt caagctcgaa ttgtgatgat tttgaggatt ttcctgtacc aatgctcatc       300
     gaaattaagc ctaagaaaaa gcttgttgag gactgggata agttaaaacc aaaattcaga       360
     gcagcccatc gttttgctgc tgataaagga tggaagttca aaattatcag tgaaacaaga       420
     ttatatgtag gacttacgca ctatcattta tag                                    453
//

If you have problems or comments...

PBIL Back to PBIL home page