(data stored in ACNUC29543 zone)

EMBL: CP000521.PE200

CP000521.PE200       Location/Qualifiers
FT   CDS_pept        complement(230959..231921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0208"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10684"
FT                   /protein_id="ABO10684.1"
FT                   /translation="MTEPNSISCTQLAETYNISHDSVNRFLEREDYTPHDLYQEAIQHI
FT                   DNNKLIVSIDDTVLDKPYSQHMDLVSYFWSGKHHRSVKGINLITLYATDQNGQNIPINF
FT                   RIYDKSESKTKNDYFMDMLSEVLSWGAKIQFITGDSWYSSTGNLKTIRKYGIRFMFGID
FT                   CNRKVSPEKGQLFQLRLLPDFHQGQVVWLKDFGFVQLFKTQLKEQQRFYIVHQDEDDLL
FT                   SFEGFHELHSSHWKIEQYHRVIKQVCHIEKFQVRRSKLILNHIFSALMAYVEIQKNQFE
FT                   GIFENVYRWQKKLFRPIIKDFIDDFILDKNHLLPQRIYK"
     atgacagaac cgaactctat tagctgcaca caacttgccg agacttataa tatctcgcat        60
     gatagtgtaa atcgctttct agagcgtgaa gactacacac ctcacgacct atatcaagaa       120
     gcaattcaac atattgataa taataaactt atagtcagta ttgatgatac tgttttagat       180
     aaaccatata gtcaacatat ggacttagtt agctattttt ggtcaggcaa acaccaccga       240
     tccgtcaagg gtattaatct cattaccttg tatgcgacag atcaaaatgg tcaaaatatt       300
     ccaattaatt tccgaattta tgacaaatct gaaagtaaaa ccaagaatga ttactttatg       360
     gatatgttaa gtgaagtact cagttggggt gcaaagattc aatttattac aggtgatagt       420
     tggtattcat cgactggaaa tctaaaaacc ataagaaaat atggtattcg atttatgttt       480
     ggtatcgact gtaaccgtaa ggtttcccca gaaaaaggac aattgtttca actgcgttta       540
     ttgccagatt tccatcaggg tcaagtggtc tggctcaaag attttggctt tgtacaatta       600
     tttaagactc agttaaaaga acagcagagg ttttatattg tgcatcaaga tgaagatgat       660
     ttattgtcct ttgagggttt tcatgaatta cattcaagtc attggaaaat agaacaatat       720
     caccgagtga ttaaacaggt ttgtcatatt gaaaagtttc aagtaagacg atctaaactg       780
     attttgaatc atattttttc agccttgatg gcctacgtcg agatacaaaa gaaccagttt       840
     gaggggatct ttgaaaatgt atatcgttgg cagaagaaat tatttagacc aatcatcaaa       900
     gacttcattg atgactttat tctcgataaa aatcatctgc taccacagag aatctataaa       960
     tga                                                                     963
//

If you have problems or comments...

PBIL Back to PBIL home page