(data stored in ACNUC29543 zone)

EMBL: CP000521.PE207

CP000521.PE207       Location/Qualifiers
FT   CDS_pept        complement(238921..239772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0214"
FT                   /product="Universal stress protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10690"
FT                   /protein_id="ABO10690.2"
FT                   /translation="MSKIIACIDGSLVTNTVCDYAAWFSDKLNSPIKLLHVIDKPKAKA
FT                   PQDLSGAIGLGSRETLLKELVELEERKGKIELEHGQILLREAKNYLLEKFSIDAQSFQR
FT                   HGSVLETIMGMEDDIRVLVMGKHGNETEHDSSKIGTHIENVVRALHKPVLITSAPFSPP
FT                   KSFLIAFDGSQTARKCVERIASSPLLKGLAVHLVYVGNPNSEMQNQLSWAKEQLESQGF
FT                   NITSNTLDGEVDKAIINYAEQHQIDLIVVGAYGHSKIRQFFIGSTTTKVITSANKPVLL
FT                   LR"
     atgtcaaaaa ttattgcatg tattgatgga tcattagtaa caaatactgt gtgtgattat        60
     gcagcttggt ttagcgataa acttaattca cctattaaac tattgcatgt cattgataag       120
     ccaaaagcaa aagcaccaca agatttaagt ggtgcaattg gtctaggaag tcgagaaacc       180
     ttgctcaaag aattggttga actcgaagaa cgtaagggaa aaatcgagct agagcatggc       240
     cagattcttc ttcgggaagc aaagaactat ttattggaga agttctctat tgatgctcaa       300
     agttttcaac gccatggcag tgttttagaa acaatcatgg gaatggaaga cgacattaga       360
     gttcttgtta tgggtaagca tgggaatgaa accgagcatg attccagtaa aattggaacc       420
     catattgaaa atgttgttcg tgcccttcat aaacccgtat taataacgtc tgcaccattt       480
     agtccaccta agtctttttt aattgctttt gatggaagtc agactgcaag aaaatgtgtt       540
     gaacgcattg cgtcaagtcc attacttaaa ggtcttgcag tacatttggt ttatgtcgga       600
     aatccgaata gtgaaatgca aaatcagctc tcttgggcaa aagagcaact tgaatcacaa       660
     ggttttaata tcacctcgaa tacgttggat ggtgaagttg ataaggcaat tatcaattac       720
     gctgaacagc atcaaatcga tttgattgtg gttggggctt atggtcattc aaagatacgt       780
     caatttttta ttggcagcac caccacaaaa gtgatcacaa gcgctaataa accagtcctg       840
     ttactacgat aa                                                           852
//

If you have problems or comments...

PBIL Back to PBIL home page