(data stored in ACNUC29543 zone)

EMBL: CP000521.PE209

CP000521.PE209       Location/Qualifiers
FT   CDS_pept        complement(241567..243363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3491"
FT                   /old_locus_tag="AS1_3491"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3491"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89916"
FT                   /protein_id="ABS89916.2"
FT                   /translation="MPVNNDKITTIDCFPNDNISRVVYRYGGLVRNEDNDSTNPFVEVL
FT                   LIEIRKSDQWLFLDKCSTFLVPVLDLDAVQHGSIWDGNVLTDQSYRFSGKLITKRFSFD
FT                   FTNNKPKNIKLTDRIPNTSDYYIPLKNYFLPNKVDYVLQGYPFTKYTNDSYRKVNHCLM
FT                   HSNDGTQVITSSIHVLHSLFVNRKDIRGLLLGTSSQSIINRFLESYTTEIVDDNVEYKI
FT                   KIRKPYEDIGETAIIFLANLALNPYVQTIVDKIQRSMEITEFNHLQQGTGKRYPIVFPP
FT                   HPTKLFLEAEGIWLDDNKTRFFITRVKKFDPINDHMIDVNKDLTNTISKPDEKNPRPRE
FT                   KSQNKNEHINTQKPPSRTSGEYRKRSEVETGNTQGILKYSFNEPTDDPIEVGASNQPYS
FT                   DKSEEVETSSDEPYGNQNTKIKKSETTDTPPSRDERFDIQYIIQSLQELASEMGSPLEH
FT                   LSAINEHGEMIASINLLQIKKLVPEPKHPSWIDYDKGRKLLFLKLDLKDQNGFSYLIDI
FT                   HKNKNHEAFCAFLIFTQNKLTSEQIKKICIELENAKGIKKWALYCDSFIHKMIAIKHLY
FT                   ATPDEWKNRFKNLFISLQKDKS"
     atgcctgtta ataatgacaa aataacgact attgattgct tcccaaacga taatattagt        60
     cgagtggttt atagatatgg tggacttgtt agaaacgaag ataacgattc aactaatcct       120
     tttgttgaag tgttattaat tgagattaga aaaagtgatc aatggttatt tttagataag       180
     tgctcaacat tccttgttcc cgtacttgat cttgatgctg ttcaacatgg cagtatttgg       240
     gatggaaatg ttttaaccga tcaatcctat cggttttcag gaaaactcat tacaaaacga       300
     ttttctttcg acttcaccaa taataaacct aagaatataa aacttacgga cagaatcccc       360
     aatacttctg actactacat tcctttaaaa aactatttcc tcccaaataa agttgattat       420
     gttcttcaag gctatccatt taccaaatat accaatgatt catatcgcaa agtgaatcat       480
     tgcctaatgc attccaatga tggaactcaa gtcatcacat catcaattca tgtattgcat       540
     agcttattcg tcaatcggaa ggatattagg ggacttttat taggaacttc gagtcaatcc       600
     atcattaatc gttttttaga atcttataca acagaaattg tggacgataa tgttgaatat       660
     aaaattaaaa tcagaaagcc atatgaagat ataggcgaga ctgcaattat ttttcttgct       720
     aatcttgcct taaacccata tgtgcaaacg atagttgata aaattcaacg aagtatggaa       780
     attaccgagt ttaatcatct tcagcagggt acaggcaaaa ggtatcccat tgtgtttcca       840
     ccacatccca caaagctttt ccttgaagca gaaggaattt ggctagatga caataagact       900
     cgttttttta tcactagagt gaaaaaattt gatcctatta acgatcacat gattgatgtc       960
     aacaaagacc tgaccaatac aatttcaaag cctgatgaga aaaatcctag acctcgtgaa      1020
     aaaagtcaaa ataagaatga gcacatcaat actcaaaaac caccatcaag aacaagcggt      1080
     gaatatcgta agcgttctga ggtggaaact ggaaatacac aaggtattct gaagtattct      1140
     tttaatgaac caaccgatga tccaattgaa gtcggagcat ctaatcaacc ttattcagat      1200
     aaatcagaag aggttgaaac atcttctgat gaaccctatg gtaatcaaaa tactaagatc      1260
     aaaaaatctg aaacgacaga tacaccacct agcagagatg aacgttttga cattcaatac      1320
     attatccaat ctctccaaga acttgcttct gaaatgggtt ctcctctgga acatctgtct      1380
     gcaattaatg aacatggtga aatgatagcg agtattaatt tgcttcaaat caaaaaactt      1440
     gtgcctgaac ccaagcatcc ctcatggatt gattatgata aagggcgaaa attattgttc      1500
     ttaaaattag acttaaaaga tcaaaatgga ttttcctatc tcatcgatat acataaaaat      1560
     aaaaatcatg aagcattttg tgcctttctt atttttactc agaataagtt aacaagcgaa      1620
     caaattaaaa aaatctgtat tgaactagaa aatgccaagg gaataaaaaa atgggcactc      1680
     tactgtgata gtttcattca taaaatgatt gcaataaaac atttatacgc aacaccagat      1740
     gaatggaaaa atcgctttaa aaatttattc ataagcttac agaaggacaa atcctaa         1797
//

If you have problems or comments...

PBIL Back to PBIL home page