(data stored in ACNUC29543 zone)

EMBL: CP000521.PE217

CP000521.PE217       Location/Qualifiers
FT   CDS_pept        complement(250436..250654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0224"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10699"
FT                   /protein_id="ABO10699.1"
FT                   /translation="MDIPHQISTQIEQLNQGEQWTFSAQELYMSHNDFNSLSILLTRAS
FT                   EKGEFSITRTQHNKPWVGTHSVTLTKH"
     atggacattc cgcatcagat ttcaacgcaa attgagcaac ttaatcaagg cgagcaatgg        60
     accttctcag cacaagaact ttatatgagt cataacgact ttaattcgct ttcaatctta       120
     ctcacacgag catcggaaaa aggcgaattt tcaattacac gcactcagca taataaacct       180
     tgggtcggca cacactcagt tactctcacc aagcattaa                              219
//

If you have problems or comments...

PBIL Back to PBIL home page