(data stored in ACNUC29543 zone)

EMBL: CP000521.PE225

CP000521.PE225       Location/Qualifiers
FT   CDS_pept        complement(258501..259013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0232"
FT                   /product="type 4 fimbriae expression regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10707"
FT                   /protein_id="ABO10707.1"
FT                   /translation="MDLILPPLRERGEDVLLLANHFIQKICMEWETPSKQLTEAAKTYL
FT                   LQQHFPGNVRELRNMIERAITLSEDATIDISHLHPAPLRANISNPFVSATQNIQTTVAA
FT                   PQVVKKLPSEGLERYLENIEKDILINALNMTHWNRTLAAKKLGMTFRSLRYRLKKFGLD
FT                   TETEQEV"
     atggacctca tattgccacc tctacgtgaa cgtggcgaag atgtcctttt actggccaat        60
     cactttattc agaaaatttg tatggagtgg gaaacgccat ctaaacaatt aacagaagcg       120
     gccaaaactt atctgctaca gcaacacttt ccgggtaatg ttcgcgaatt aagaaatatg       180
     attgagcgcg caattacctt aagtgaagac gccaccatag atatatctca tttacatcct       240
     gctcctctaa gagcgaatat ttctaatcct tttgtttcgg ctactcaaaa catacaaacc       300
     actgtggcgg ctcctcaagt cgtaaaaaaa ttaccaagtg aaggcttaga acgttattta       360
     gaaaatattg aaaaagatat tttaatcaat gccctcaata tgactcattg gaatcgtacc       420
     ttagcagcta aaaaattagg aatgactttc cgctctttac gctatcgtct gaaaaaattt       480
     ggattagata cggagacaga acaggaagta taa                                    513
//

If you have problems or comments...

PBIL Back to PBIL home page