(data stored in ACNUC29543 zone)

EMBL: CP000521.PE226

CP000521.PE226       Location/Qualifiers
FT   CDS_pept        complement(259094..259297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0233"
FT                   /product="type 4 fimbriae expression regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10708"
FT                   /protein_id="ABO10708.1"
FT                   /translation="MFGHKKGSFTGATQDKQGLILSAHGGSLFLDEIAELPLSMQVKLL
FT                   RAVQEKRSDLSVQIRKSMLISV"
     ttgtttgggc ataaaaaagg gagctttacc ggagcaactc aagataagca aggtctcatt        60
     ttatcggcac acggtggcag tttattttta gatgaaattg ccgaattacc tttaagtatg       120
     caggtcaaac tgctccgcgc agtacaggaa aaaagatccg acctgtcggt tcagatcagg       180
     aaatcgatgt tgatttccgt gtga                                              204
//

If you have problems or comments...

PBIL Back to PBIL home page