(data stored in ACNUC29543 zone)

EMBL: CP000521.PE229

CP000521.PE229       Location/Qualifiers
FT   CDS_pept        complement(261526..262161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0236"
FT                   /product="response regulator"
FT                   /note="Global antibiotic and cyanide control protein
FT                   LuxR/UhpA family"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10711"
FT                   /protein_id="ABO10711.2"
FT                   /translation="MITVLVVDDHELVRTGICRMLEDHADVEVIGQAESGEEAIAIVRQ
FT                   QHPQVVLLDVNMPGIGGVETTRRLLQTAPETKVIAVSGLAEEPYPSLLLKAGAKGYITK
FT                   GAPIAEMVRAINKVMQGGKYFSADIAEQLASSYLSDTQQSPFDSLSEREMQVAMMVVNC
FT                   ISAQEIADKLFVSVKTVNTYRYRIFEKLGIDSDVKLTHLAIRYGLIKP"
     ttgattacag ttttagttgt cgatgaccat gaactggtac gtacgggtat ttgccgtatg        60
     ttagaagatc atgccgatgt tgaggtaatt ggacaagccg aatcgggcga agaagcaatt       120
     gctatcgttc gccaacaaca tccgcaagtc gtactgctgg atgtcaatat gccgggcatc       180
     ggtggcgtag aaacaacccg tcgtttatta cagacggctc cagagacaaa agtcattgct       240
     gtaagcggcc tcgccgaaga gccttaccca tctttattat taaaagccgg tgcaaaaggc       300
     tatatcacta aaggcgcgcc aattgccgaa atggttcgtg caattaataa ggtcatgcaa       360
     ggcggtaaat attttagtgc agatattgcc gaacaactcg cgagctcata tttatccgac       420
     actcaacaat ccccttttga ttcgttatcg gaacgggaaa tgcaagttgc aatgatggtc       480
     gtcaactgta ttagcgccca agaaattgcc gataaacttt ttgtaagtgt gaaaactgta       540
     aatacttacc gttatcgtat ttttgaaaag ttaggaattg atagcgatgt aaaactaaca       600
     catcttgcga ttcgttacgg tttgatcaag ccataa                                 636
//

If you have problems or comments...

PBIL Back to PBIL home page