(data stored in ACNUC29543 zone)

EMBL: CP000521.PE23

CP000521.PE23        Location/Qualifiers
FT   CDS_pept        30807..31940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0023"
FT                   /product="putative malic acid transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10518"
FT                   /protein_id="ABO10518.2"
FT                   /translation="MKRPFYQLNQSKDVIRHFTPNWFTATMGTGVVSMILIQLPFAKSF
FT                   LFMLATLLWQFNIVLFSVFSVLYLLRWLLFPHEAKQIFNHPNMSLFLGAIPMGLATILN
FT                   GFLSFGIGLYGEVAVHIAQALWYIDVFLALAIAWIVPFCMFSRQNHQLHTMTAIWLLPV
FT                   VACEVAASSAGMLVAHLPTDVHSFHLLLAGYVLWGISVLPAFAILTILMLRMALHQLPE
FT                   KEVAISSWLSLGPIGTGALGLLLLGEQAQRVFVNVGFPELAHVFQALGVVGSLVLLGFG
FT                   LWWLGLAILTTLRHAKTGIPFNLGWWGLTFPFGVFILALFNLGHQIEVVFLQYVAVAFS
FT                   ILLLVMWSGVMKKTLAGAYSGKLFFSPCLVALQQRMQ"
     atgaaaagac ccttttacca attaaatcaa agtaaagatg ttatacggca ttttacccca        60
     aattggttta cagcaactat gggtactggc gtggtcagta tgattttaat tcagcttcca       120
     tttgccaaat catttttatt tatgctggct acgctgttat ggcaatttaa tattgttcta       180
     tttagtgttt tttcagttct ctatttattg cggtggttac tcttcccgca tgaagcgaag       240
     caaatattta atcatccaaa tatgagcttg tttttaggtg ctataccgat ggggcttgca       300
     accatactaa atggcttttt aagcttcgga atcggacttt acggcgaagt ggcagttcat       360
     atcgcccaag ctttgtggta catcgacgtt tttttagcac tagcaattgc atggatcgta       420
     ccattttgca tgtttagccg tcagaatcat cagctacata ccatgactgc aatttggttg       480
     ttacctgtag ttgcttgtga agtcgcagca agttctgcgg gcatgttggt tgcacattta       540
     ccaacagatg tgcatagctt tcatttattg ttagcgggtt acgtactttg gggaatctct       600
     gttttacctg catttgccat tttaacgatt ttaatgttgc gtatggcttt gcatcagtta       660
     ccagaaaaag aagtcgcgat ttctagctgg ctttctttag gcccgattgg gacaggtgct       720
     ttaggcctat tgttgctagg tgagcaggca caaagagtat ttgtaaatgt tggctttcct       780
     gagttggccc atgtatttca agccttgggc gttgtgggta gtctggtact tttaggcttt       840
     gggttatggt ggcttggcct tgcgatttta acaacacttc gtcatgcaaa gacaggtatt       900
     ccatttaact tgggttggtg gggcttaacc ttcccatttg gtgtgtttat tttggcttta       960
     tttaatttag gtcatcagat tgaagttgta tttttacaat acgtcgctgt ggcattcagt      1020
     attttattat tagtgatgtg gagcggggta atgaagaaaa ccttagccgg agcatacagt      1080
     ggcaagctat tcttctctcc atgtttggtg gctttacaac aaagaatgca gtaa            1134
//

If you have problems or comments...

PBIL Back to PBIL home page