(data stored in ACNUC29543 zone)

EMBL: CP000521.PE231

CP000521.PE231       Location/Qualifiers
FT   CDS_pept        complement(263529..264668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0238"
FT                   /product="threonine synthase
FT                   pyridoxal-5'-phosphate-dependent enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10713"
FT                   /protein_id="ABO10713.2"
FT                   /translation="MSNANRYTGLVDRYRDRLPVSATTRAISLGEGNTPLIKLENIPRI
FT                   IGKDVEIYVKYEGLNPTGSFKDRGMTMAVTKAVEEGSKAIICASTGNTSAAAAAYAARA
FT                   GIKAFVLIPEGKIAMGKMAQAMMYGAITMQIRGNFDDGMRLVKEVADQAPVTIVNSINP
FT                   YRLQGQKTIAYEIVEALGRAPDYHCLPVGNAGNITAHWMGYTEAVANQPADQFEQVVYD
FT                   AATDQFTGPKPEGLPTMVGYQASGAAPFLRGAPVEKPETVATAIRIGNPQSWNHAKAVV
FT                   RDSKGWFDELQDSEILEAQRLLSMYEGVFVEPASAASIGGAIRDIKAGKIAEGSVIVCT
FT                   VTGNGLKDPDTAIKQCADAVMLSIDATMDQVKDSILSNM"
     atgtctaatg ccaatcgtta tactggtctt gtagatcgtt atcgtgaccg tttgccagtt        60
     tcggcaacta ctcgtgctat ctctttgggt gaaggcaaca cccctctcat taaacttgag       120
     aatattccac gtattattgg caaagacgtt gaaatttatg tgaaatacga gggcttaaac       180
     ccgactggtt catttaaaga ccgtggtatg accatggctg taaccaaagc agttgaagaa       240
     ggctctaaag caattatctg tgcatctaca ggtaacactt ctgctgctgc tgctgcctat       300
     gctgcacgcg caggtatcaa agcatttgtt ttgattccgg aaggcaaaat tgcgatgggt       360
     aaaatggcgc aagccatgat gtatggtgcg atcactatgc aaatccgtgg taacttcgat       420
     gatggtatgc gtcttgtaaa agaagtggct gatcaagcac ctgtaacgat tgtaaactca       480
     atcaaccctt accgtttgca aggtcaaaaa actattgctt atgaaatcgt tgaagcttta       540
     ggccgtgcac ctgattacca ctgcttacca gttggtaacg caggtaacat tacagctcac       600
     tggatgggtt ataccgaagc agtagcaaac caacctgctg accaatttga acaagttgtt       660
     tatgacgctg cgactgatca attcactggt ccaaaaccag aaggcttacc aacaatggta       720
     ggttatcaag cttctggcgc agctcctttc ttacgtggtg ctccagtaga aaaaccggaa       780
     acagttgcaa ctgcgattcg tattggtaac ccacaaagct ggaaccatgc aaaagctgta       840
     gtacgcgact ctaaaggttg gttcgatgaa cttcaagaca gcgaaatttt agaagctcaa       900
     cgcttacttt ctatgtatga aggtgtattt gttgagccag catctgctgc ttctattggc       960
     ggtgcaatcc gtgacattaa agccggtaag attgctgaag gttctgtaat tgtatgtaca      1020
     gtaacgggta atggcttgaa agaccctgat acagcaatta aacaatgtgc tgatgcagtg      1080
     atgttgtcaa ttgatgcaac aatggaccaa gtaaaagatt cgattttatc taatatgtaa      1140
//

If you have problems or comments...

PBIL Back to PBIL home page