(data stored in ACNUC29543 zone)

EMBL: CP000521.PE235

CP000521.PE235       Location/Qualifiers
FT   CDS_pept        268260..268559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0242"
FT                   /product="putative ferrous iron transport protein A"
FT                   /note="FeoA"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10717"
FT                   /protein_id="ABO10717.2"
FT                   /translation="MYTSKKGLGSDAVRLSALKVKQAATITKVNRIEVESEQQDLVAIR
FT                   LESLGFVPGTRVEVITKGVFGGDPILIQIGFTRFALRKAEAEKIEIQVEEGVPA"
     atgtatacta gtaaaaaagg tttaggatcg gatgcggtgc gtttatcagc gttgaaagtg        60
     aagcaagcgg cgaccatcac caaagtgaat cggatagaag tagagtccga gcagcaagat       120
     ttggtcgcaa ttcgtttgga aagtctgggt tttgtaccag gcacgcgagt ggaagtgatt       180
     accaagggtg tttttggtgg tgatccgatc ttaatccaaa ttggctttac tcgtttcgct       240
     ttacgtaaag cagaagcgga aaaaatcgaa attcaagtag aagaaggagt acccgcatga       300
//

If you have problems or comments...

PBIL Back to PBIL home page