(data stored in ACNUC29543 zone)

EMBL: CP000521.PE237

CP000521.PE237       Location/Qualifiers
FT   CDS_pept        270430..270681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0244"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10719"
FT                   /protein_id="ABO10719.2"
FT                   /translation="MLQYLIIAVLVIWSAVVVFKKVFPKTANSAFSALSVFCEKQGWAT
FT                   LAKWLKPKMTFGCAGGCGCSSEDKPTNTVQEIKPVKWQ"
     atgcttcaat atctgattat tgcggttttg gtgatttgga gtgctgttgt tgtttttaag        60
     aaagtatttc caaaaacagc aaactcggcc ttttcagcac tatccgtttt ttgtgaaaag       120
     caggggtggg caactttagc aaaatggctg aaaccaaaaa tgacttttgg ttgtgcaggt       180
     ggctgtggct gctcaagtga agataaacca actaatacag ttcaagaaat taaaccagtt       240
     aaatggcaat aa                                                           252
//

If you have problems or comments...

PBIL Back to PBIL home page