(data stored in ACNUC29543 zone)

EMBL: CP000521.PE239

CP000521.PE239       Location/Qualifiers
FT   CDS_pept        272213..273409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0246"
FT                   /product="cell division protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10721"
FT                   /protein_id="ABO10721.2"
FT                   /translation="MAGLAQTTIQKINHWYERILPKWPAEVTPRNVLIFCVVALLCIGS
FT                   VMVASASMPYAEYMHENPFHYVIRHGISIVAAGVVAYLTYRISLNTWFKNTFPLWLLTM
FT                   VLLLAALAVGSEVNGSTRWIKIGGFTLQPTEVAKVMMAIFTADYVVRRAKEVRTHWKGL
FT                   LRLSGVMAITVGLIIAEPDLGATVVIVMMMVGVFFLAGAPPTQFLIMLGAIVTGIVFLI
FT                   LFEPYRFQRLISFTDPWADPLGVGYQLSNALMAFGRGEWFGTGLGHSVQKLSYLPEAHT
FT                   DFMLAVLGEEFGFFGISIVIGLSFLMLACCIKIGHRALKHHYLRAGYLAYGISIIFLLQ
FT                   ILVNAGMNMGLMPTKGLTLPFISYGGTSLMMCAAMISLILKIDASTQEVNPEREESNF"
     atggcaggct tagctcagac cacaatccag aaaatcaatc attggtatga acggatattg        60
     ccgaaatggc cagcggaagt gacgccacgt aatgtcttga ttttctgtgt ggttgcattg       120
     ttatgtatcg gttcggtgat ggtcgcatct gcttccatgc cttatgctga atatatgcat       180
     gaaaacccat ttcactatgt gattcgtcat gggatctcaa tcgttgctgc tggcgtggtg       240
     gcttatttaa cctatcgaat atcactcaat acatggttta aaaatacgtt tccattgtgg       300
     ttattgacca tggttctgtt acttgcggct ttggctgtag gttcggaagt taacggttcc       360
     acacgttgga ttaaaattgg tggttttacc ttgcagccaa cagaggttgc caaggttatg       420
     atggccatct ttaccgcaga ttacgtagta cgccgtgcta aagaagtccg tacccactgg       480
     aaaggcttac ttcgtttaag tggcgttatg gcaattacgg taggtttaat tattgccgag       540
     cctgacttgg gtgcgacggt ggttattgtc atgatgatgg tcggggtgtt ctttttagcg       600
     ggtgcgcctc caacacaatt cttaatcatg cttggtgcaa ttgtcacggg tattgtgttt       660
     ttaattttat ttgaacctta ccgtttccaa cgtttgattt cgtttactga cccttgggcg       720
     gacccattag gggtaggtta tcagttatca aatgcgttaa tggcttttgg tcgtggtgag       780
     tggtttggta caggcttggg gcatagtgtt caaaagcttt cctatttacc agaagcgcat       840
     actgacttta tgttggctgt gttaggtgaa gaatttggtt tctttggtat ttcgattgtc       900
     attggcttat ctttcttgat gctggcatgt tgtatcaaaa tcggccaccg tgccttgaaa       960
     catcattatc ttcgcgcagg ctatttggct tacggtatta gtattatttt cttactccag      1020
     attttggtaa atgcgggtat gaacatgggc ttaatgccaa ccaaaggttt aactctgcca      1080
     tttattagtt atggtggtac gtctttaatg atgtgtgcag ctatgattag cttgatctta      1140
     aagattgatg cttcaactca agaagtgaac cctgagaggg aagaatcaaa cttctaa         1197
//

If you have problems or comments...

PBIL Back to PBIL home page