(data stored in ACNUC29543 zone)

EMBL: CP000521.PE250

CP000521.PE250       Location/Qualifiers
FT   CDS_pept        complement(284091..284360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0257"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10732"
FT                   /db_xref="GOA:A3M1D8"
FT                   /db_xref="InterPro:IPR007457"
FT                   /db_xref="InterPro:IPR036766"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3M1D8"
FT                   /protein_id="ABO10732.2"
FT                   /translation="MSRQVFCRKYQKEMEGLDFAPFPGAKGQEFFENVSKQAWQEWLQH
FT                   QTTLINEKRLNVFEPEAKKFLEEQREKFFNNDESVEKAEGWKPE"
     atgagtcgac aagtattttg ccgtaaatac caaaaggaaa tggaaggatt ggacttcgct        60
     ccatttccag gtgccaaagg ccaagaattt tttgaaaatg tttctaagca agcatggcaa       120
     gaatggttac agcaccaaac tacgctaatt aatgaaaagc gtttaaacgt gtttgaacca       180
     gaagcgaaaa aattccttga agagcaacgt gagaagttct tcaataatga tgagagcgtt       240
     gaaaaagcgg aaggctggaa accagaataa                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page